Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
80317
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger with KRAB and SCAN domains 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZKSCAN3
Synonyms (NCBI Gene) Gene synonyms aliases
ZF47, ZFP306, ZNF306, ZNF309, ZSCAN13, ZSCAN35, Zfp47, dJ874C20.1, dJ874C20.1., zfp-47
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p22.1
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT029358 hsa-miR-26b-5p Microarray 19088304
MIRT670262 hsa-miR-4310 HITS-CLIP 23824327
MIRT670261 hsa-miR-7157-5p HITS-CLIP 23824327
MIRT670260 hsa-miR-338-3p HITS-CLIP 23824327
MIRT670259 hsa-miR-6499-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 18940803
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 18940803
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0001227 Function DNA-binding transcription repressor activity, RNA polymerase II-specific IDA 18940803
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612791 13853 ENSG00000189298
Protein
UniProt ID Q9BRR0
Protein name Zinc finger protein with KRAB and SCAN domains 3 (Zinc finger and SCAN domain-containing protein 13) (Zinc finger protein 306) (Zinc finger protein 309) (Zinc finger protein 47 homolog) (Zf47) (Zfp-47)
Protein function Transcriptional factor that binds to the consensus sequence 5'-[GT][AG][AGT]GGGG-3' and acts as a repressor of autophagy. Specifically represses expression of genes involved in autophagy and lysosome biogenesis/function such as MAP1LC3B, ULK1 or
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02023 SCAN 42 131 SCAN domain Domain
PF01352 KRAB 213 253 KRAB box Family
PF00096 zf-C2H2 314 336 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 342 364 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 370 392 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 398 420 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 426 448 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 480 502 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 508 530 Zinc finger, C2H2 type Domain
Sequence
MARELSESTALDAQSTEDQMELLVIKVEEEEAGFPSSPDLGSEGSRERFRGFRYPEAAGP
REALSRLRELCRQWLQPEMHSKEQILELLVLEQFLTILPGNLQSWVREQHPESGEEVVVL
LEYLERQLDEP
APQVSGVDQGQELLCCKMALLTPAPGSQSSQFQLMKALLKHESVGSQPL
QDRVLQVPVLAHGGCCREDKVVASRLTPESQGLLKVEDVALTLTPEWTQQDSSQGNLCRD
EKQENHGSLVSLG
DEKQTKSRDLPPAEELPEKEHGKISCHLREDIAQIPTCAEAGEQEGR
LQRKQKNATGGRRHICHECGKSFAQSSGLSKHRRIHTGEKPYECEECGKAFIGSSALVIH
QRVH
TGEKPYECEECGKAFSHSSDLIKHQRTHTGEKPYECDDCGKTFSQSCSLLEHHRIH
TGEKPYQCSMCGKAFRRSSHLLRHQRIHTGDKNVQEPEQGEAWKSRMESQLENVETPMSY
KCNECERSFTQNTGLIEHQKIH
TGEKPYQCNACGKGFTRISYLVQHQRSHVGKNILSQ
Sequence length 538
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Generic Transcription Pathway
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Breast carcinoma Breast Carcinoma rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451
View all (71 more)
29059683
Colorectal cancer Colorectal Carcinoma rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800
View all (467 more)
18519692
Colorectal neoplasms Colorectal Neoplasms rs28929483, rs63751108, rs28929484, rs63749831, rs63750047, rs63751207, rs63749811, rs1553350126, rs63750875, rs63750955, rs587776706, rs63750871, rs587776715, rs63751466, rs63750049
View all (1682 more)
18519692
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)
28540026
Unknown
Disease term Disease name Evidence References Source
Cervical Cancer Cervical Cancer Our screens identified 10 miRNAs that enhance fitness of HeLa cells and have been reported to be up-regulated in cervical cancer (Table2). GWAS, CBGDA
Neuroticism Neuroticism GWAS
Breast Cancer Breast Cancer Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients GWAS, CBGDA
Myocardial Infarction Myocardial Infarction GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Stimulate 36012568
Carcinogenesis Associate 30241382
Cell Transformation Viral Associate 22529291
Colorectal Neoplasms Associate 30241382, 36012568
Leukemia Plasma Cell Associate 22529291
Multiple Myeloma Associate 21057542
Neoplasms Associate 21057542, 36012568
Polyps Associate 36012568
Precancerous Conditions Stimulate 36012568
Prostatic Neoplasms Associate 30241382, 36012568