Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	80312
Gene name Gene Name - the full gene name approved by the HGNC.	Tet methylcytosine dioxygenase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TET1
Synonyms (NCBI Gene) Gene synonyms aliases	CXXC6, LCX, bA119F7.1
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10q21.3
Summary Summary of gene provided in NCBI Entrez Gene.	DNA methylation is an epigenetic mechanism that is important for controlling gene expression. The protein encoded by this gene is a demethylase that belongs to the TET (ten-eleven translocation) family. Members of the TET protein family play a role in the

Show/Hide all(260)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004419	hsa-miR-29b-3p	qRT-PCR, Luciferase reporter assay, Western blot	19850741
MIRT004420	hsa-miR-29a-3p	qRT-PCR	19850741
MIRT030814	hsa-miR-21-5p	Microarray	18591254
MIRT039236	hsa-miR-454-3p	CLASH	23622248
MIRT037234	hsa-miR-877-5p	CLASH	23622248
MIRT004420	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23857059
MIRT004420	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23857059
MIRT004420	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23857059
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR, Western blot	23857059
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR, Western blot	23857059
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR, Western blot	23857059
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR, Western blot	23857059
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR, Western blot	23857059
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR, Western blot	23857059
MIRT004420	hsa-miR-29a-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23820384
MIRT004420	hsa-miR-29a-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23820384
MIRT004420	hsa-miR-29a-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23820384
MIRT004420	hsa-miR-29a-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23820384
MIRT640760	hsa-miR-205-3p	HITS-CLIP	23824327
MIRT640759	hsa-miR-3065-5p	HITS-CLIP	23824327
MIRT640758	hsa-miR-7159-5p	HITS-CLIP	23824327
MIRT640757	hsa-miR-505-3p	HITS-CLIP	23824327
MIRT640756	hsa-miR-421	HITS-CLIP	23824327
MIRT621854	hsa-miR-4263	HITS-CLIP	23824327
MIRT621852	hsa-miR-576-5p	HITS-CLIP	23824327
MIRT640755	hsa-miR-1305	HITS-CLIP	23824327
MIRT621857	hsa-miR-5571-5p	HITS-CLIP	23824327
MIRT621856	hsa-miR-4778-5p	HITS-CLIP	23824327
MIRT621855	hsa-miR-4735-5p	HITS-CLIP	23824327
MIRT621853	hsa-miR-3686	HITS-CLIP	23824327
MIRT621854	hsa-miR-4263	HITS-CLIP	23824327
MIRT621852	hsa-miR-576-5p	HITS-CLIP	23824327
MIRT004420	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	27555295
MIRT004420	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	27555295
MIRT382486	hsa-miR-141-3p	qRT-PCR	27198154
MIRT382486	hsa-miR-141-3p	qRT-PCR	27198154
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004419	hsa-miR-29b-3p	Luciferase reporter assay, Western blot	26776158
MIRT004420	hsa-miR-29a-3p	Microarray, qRT-PCR	26251039
MIRT734564	hsa-miR-767-5p	Western blotting, Immunohistochemistry (IHC), qRT-PCR	31844675
MIRT736345	hsa-miR-191-5p	Luciferase reporter assay, Western blotting, qRT-PCR	32003827
MIRT640760	hsa-miR-205-3p	HITS-CLIP	23824327
MIRT640759	hsa-miR-3065-5p	HITS-CLIP	23824327
MIRT640758	hsa-miR-7159-5p	HITS-CLIP	23824327
MIRT640757	hsa-miR-505-3p	HITS-CLIP	23824327
MIRT640756	hsa-miR-421	HITS-CLIP	23824327
MIRT621854	hsa-miR-4263	HITS-CLIP	23824327
MIRT621852	hsa-miR-576-5p	HITS-CLIP	23824327
MIRT640755	hsa-miR-1305	HITS-CLIP	23824327
MIRT621857	hsa-miR-5571-5p	HITS-CLIP	23824327
MIRT621856	hsa-miR-4778-5p	HITS-CLIP	23824327
MIRT621855	hsa-miR-4735-5p	HITS-CLIP	23824327
MIRT621853	hsa-miR-3686	HITS-CLIP	23824327
MIRT621854	hsa-miR-4263	HITS-CLIP	23824327
MIRT621852	hsa-miR-576-5p	HITS-CLIP	23824327
MIRT755464	hsa-miR-27a-3p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunohistochemistry (IHC)	35978806
MIRT1418577	hsa-miR-1200	CLIP-seq
MIRT1418578	hsa-miR-128	CLIP-seq
MIRT1418579	hsa-miR-1297	CLIP-seq
MIRT1418580	hsa-miR-1303	CLIP-seq
MIRT1418581	hsa-miR-155	CLIP-seq
MIRT1418582	hsa-miR-200b	CLIP-seq
MIRT1418583	hsa-miR-200c	CLIP-seq
MIRT1418584	hsa-miR-217	CLIP-seq
MIRT1418585	hsa-miR-26a	CLIP-seq
MIRT1418586	hsa-miR-26b	CLIP-seq
MIRT1418587	hsa-miR-27a	CLIP-seq
MIRT1418588	hsa-miR-27b	CLIP-seq
MIRT1418589	hsa-miR-3120-3p	CLIP-seq
MIRT1418590	hsa-miR-3123	CLIP-seq
MIRT1418591	hsa-miR-3140-3p	CLIP-seq
MIRT1418592	hsa-miR-3646	CLIP-seq
MIRT1418593	hsa-miR-365	CLIP-seq
MIRT1418594	hsa-miR-3653	CLIP-seq
MIRT1418595	hsa-miR-3658	CLIP-seq
MIRT1418596	hsa-miR-3919	CLIP-seq
MIRT1418597	hsa-miR-3923	CLIP-seq
MIRT1418598	hsa-miR-429	CLIP-seq
MIRT1418599	hsa-miR-4418	CLIP-seq
MIRT1418600	hsa-miR-4426	CLIP-seq
MIRT1418601	hsa-miR-4436b-3p	CLIP-seq
MIRT1418602	hsa-miR-4465	CLIP-seq
MIRT1418603	hsa-miR-450b-5p	CLIP-seq
MIRT1418604	hsa-miR-452	CLIP-seq
MIRT1418605	hsa-miR-4647	CLIP-seq
MIRT1418606	hsa-miR-4662b	CLIP-seq
MIRT1418607	hsa-miR-4666-5p	CLIP-seq
MIRT1418608	hsa-miR-4668-3p	CLIP-seq
MIRT1418609	hsa-miR-4672	CLIP-seq
MIRT1418610	hsa-miR-4676-3p	CLIP-seq
MIRT1418611	hsa-miR-4680-5p	CLIP-seq
MIRT1418612	hsa-miR-4698	CLIP-seq
MIRT1418613	hsa-miR-4719	CLIP-seq
MIRT1418614	hsa-miR-4761-5p	CLIP-seq
MIRT1418615	hsa-miR-4793-3p	CLIP-seq
MIRT1418616	hsa-miR-4795-3p	CLIP-seq
MIRT1418617	hsa-miR-498	CLIP-seq
MIRT1418618	hsa-miR-507	CLIP-seq
MIRT1418619	hsa-miR-509-3-5p	CLIP-seq
MIRT1418620	hsa-miR-509-5p	CLIP-seq
MIRT1418621	hsa-miR-513a-5p	CLIP-seq
MIRT1418622	hsa-miR-548ad	CLIP-seq
MIRT1418623	hsa-miR-548c-3p	CLIP-seq
MIRT1418624	hsa-miR-557	CLIP-seq
MIRT1418625	hsa-miR-569	CLIP-seq
MIRT1418626	hsa-miR-607	CLIP-seq
MIRT1418627	hsa-miR-618	CLIP-seq
MIRT1418628	hsa-miR-628-3p	CLIP-seq
MIRT1418629	hsa-miR-630	CLIP-seq
MIRT1418630	hsa-miR-649	CLIP-seq
MIRT1418631	hsa-miR-656	CLIP-seq
MIRT2125528	hsa-miR-1276	CLIP-seq
MIRT1418580	hsa-miR-1303	CLIP-seq
MIRT2125529	hsa-miR-150	CLIP-seq
MIRT2125530	hsa-miR-183	CLIP-seq
MIRT2125531	hsa-miR-191	CLIP-seq
MIRT2125532	hsa-miR-3152-3p	CLIP-seq
MIRT2125533	hsa-miR-337-3p	CLIP-seq
MIRT2125534	hsa-miR-3662	CLIP-seq
MIRT2125535	hsa-miR-376a	CLIP-seq
MIRT2125536	hsa-miR-376b	CLIP-seq
MIRT2125537	hsa-miR-4265	CLIP-seq
MIRT2125538	hsa-miR-4296	CLIP-seq
MIRT2125539	hsa-miR-4311	CLIP-seq
MIRT2125540	hsa-miR-4321	CLIP-seq
MIRT2125541	hsa-miR-4322	CLIP-seq
MIRT2125542	hsa-miR-4417	CLIP-seq
MIRT2125543	hsa-miR-4424	CLIP-seq
MIRT2125544	hsa-miR-4464	CLIP-seq
MIRT1418603	hsa-miR-450b-5p	CLIP-seq
MIRT1418609	hsa-miR-4672	CLIP-seq
MIRT2125545	hsa-miR-4732-5p	CLIP-seq
MIRT2125546	hsa-miR-4748	CLIP-seq
MIRT2125547	hsa-miR-4775	CLIP-seq
MIRT2125548	hsa-miR-494	CLIP-seq
MIRT1418618	hsa-miR-507	CLIP-seq
MIRT2125549	hsa-miR-516a-3p	CLIP-seq
MIRT1418624	hsa-miR-557	CLIP-seq
MIRT2125550	hsa-miR-587	CLIP-seq
MIRT2125551	hsa-miR-595	CLIP-seq
MIRT2347890	hsa-miR-1273g	CLIP-seq
MIRT1418578	hsa-miR-128	CLIP-seq
MIRT2347891	hsa-miR-141	CLIP-seq
MIRT2347892	hsa-miR-200a	CLIP-seq
MIRT2347893	hsa-miR-21	CLIP-seq
MIRT2347894	hsa-miR-29a	CLIP-seq
MIRT2347895	hsa-miR-29b	CLIP-seq
MIRT2347896	hsa-miR-29c	CLIP-seq
MIRT1418589	hsa-miR-3120-3p	CLIP-seq
MIRT1418592	hsa-miR-3646	CLIP-seq
MIRT1418594	hsa-miR-3653	CLIP-seq
MIRT1418595	hsa-miR-3658	CLIP-seq
MIRT2347897	hsa-miR-3682-3p	CLIP-seq
MIRT2347898	hsa-miR-3942-5p	CLIP-seq
MIRT2347899	hsa-miR-431	CLIP-seq
MIRT2125543	hsa-miR-4424	CLIP-seq
MIRT1418600	hsa-miR-4426	CLIP-seq
MIRT2347900	hsa-miR-4503	CLIP-seq
MIRT1418605	hsa-miR-4647	CLIP-seq
MIRT1418606	hsa-miR-4662b	CLIP-seq
MIRT1418609	hsa-miR-4672	CLIP-seq
MIRT1418611	hsa-miR-4680-5p	CLIP-seq
MIRT1418612	hsa-miR-4698	CLIP-seq
MIRT2347901	hsa-miR-4703-5p	CLIP-seq
MIRT2347902	hsa-miR-4711-3p	CLIP-seq
MIRT2125545	hsa-miR-4732-5p	CLIP-seq
MIRT2347903	hsa-miR-4764-5p	CLIP-seq
MIRT2347904	hsa-miR-590-5p	CLIP-seq
MIRT1418627	hsa-miR-618	CLIP-seq
MIRT2347905	hsa-miR-892a	CLIP-seq
MIRT1418579	hsa-miR-1297	CLIP-seq
MIRT1418585	hsa-miR-26a	CLIP-seq
MIRT1418586	hsa-miR-26b	CLIP-seq
MIRT2347894	hsa-miR-29a	CLIP-seq
MIRT2347895	hsa-miR-29b	CLIP-seq
MIRT2347896	hsa-miR-29c	CLIP-seq
MIRT2433800	hsa-miR-3121-3p	CLIP-seq
MIRT2433801	hsa-miR-3159	CLIP-seq
MIRT2433802	hsa-miR-4320	CLIP-seq
MIRT1418602	hsa-miR-4465	CLIP-seq
MIRT1418616	hsa-miR-4795-3p	CLIP-seq
MIRT1418617	hsa-miR-498	CLIP-seq
MIRT1418623	hsa-miR-548c-3p	CLIP-seq
MIRT1418631	hsa-miR-656	CLIP-seq
MIRT2440941	hsa-miR-147	CLIP-seq
MIRT2347893	hsa-miR-21	CLIP-seq
MIRT2440942	hsa-miR-3691-5p	CLIP-seq
MIRT2440943	hsa-miR-3911	CLIP-seq
MIRT2440944	hsa-miR-4752	CLIP-seq
MIRT2440945	hsa-miR-4760-3p	CLIP-seq
MIRT2347904	hsa-miR-590-5p	CLIP-seq
MIRT2440946	hsa-miR-644	CLIP-seq
MIRT2347905	hsa-miR-892a	CLIP-seq
MIRT2640724	hsa-miR-127-5p	CLIP-seq
MIRT1418597	hsa-miR-3923	CLIP-seq
MIRT1418628	hsa-miR-628-3p	CLIP-seq
MIRT2640725	hsa-miR-653	CLIP-seq
MIRT2640724	hsa-miR-127-5p	CLIP-seq
MIRT1418597	hsa-miR-3923	CLIP-seq
MIRT1418628	hsa-miR-628-3p	CLIP-seq
MIRT2640725	hsa-miR-653	CLIP-seq

Show/Hide all(22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001826	Process	Inner cell mass cell differentiation	ISS
GO:0003677	Function	DNA binding	IDA	19372391
GO:0005506	Function	Iron ion binding	IDA	19372391
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IC	19372391
GO:0006211	Process	5-methylcytosine catabolic process	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006493	Process	Protein O-linked glycosylation	ISS
GO:0008270	Function	Zinc ion binding	IDA	29276034
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	25284789
GO:0008327	Function	Methyl-CpG binding	IDA	29276034
GO:0019827	Process	Stem cell population maintenance	ISS
GO:0031062	Process	Positive regulation of histone methylation	IMP	25284789
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA	21873635
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0070579	Function	Methylcytosine dioxygenase activity	IBA	21873635
GO:0070579	Function	Methylcytosine dioxygenase activity	IDA	19372391
GO:0070579	Function	Methylcytosine dioxygenase activity	IMP	21496894, 25284789
GO:0070989	Process	Oxidative demethylation	IBA	21873635
GO:0080111	Process	DNA demethylation	IBA	21873635
GO:0080111	Process	DNA demethylation	IMP	21496894
GO:0090310	Process	Negative regulation of DNA methylation-dependent heterochromatin assembly	IMP	21496894

MIM	HGNC	e!Ensembl
607790	29484	ENSG00000138336

Protein

UniProt ID

Q8NFU7

Protein name

Methylcytosine dioxygenase TET1 (EC 1.14.11.80) (CXXC-type zinc finger protein 6) (Leukemia-associated protein with a CXXC domain) (Ten-eleven translocation 1 gene protein)

Protein function

Dioxygenase that plays a key role in active DNA demethylation, by catalyzing the sequential oxidation of the modified genomic base 5-methylcytosine (5mC) into 5-hydroxymethylcytosine (5hmC), 5-formylcytosine (5fC), and 5-carboxylcytosine (5caC)

PDB

6ASD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02008	zf-CXXC	583 → 624	CXXC zinc finger domain	Domain
PF12851	Tet_JBP	1580 → 2052	Oxygenase domain of the 2OGFeDO superfamily	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in fetal heart, lung and brain, and in adult skeletal muscle, thymus and ovary. Not detected in adult heart, lung or brain. Up-regulated in glioblastoma cells (at protein level) (PubMed:25284789). {ECO:0000269|PubMed:12124344

Sequence

MSRSRHARPSRLVRKEDVNKKKKNSQLRKTTKGANKNVASVKTLSPGKLKQLIQERDVKK
KTEPKPPVPVRSLLTRAGAARMNLDRTEVLFQNPESLTCNGFTMALRSTSLSRRLSQPPL
VVAKSKKVPLSKGLEKQHDCDYKILPALGVKHSENDSVPMQDTQVLPDIETLIGVQNPSL
LKGKSQETTQFWSQRVEDSKINIPTHSGPAAEILPGPLEGTRCGEGLFSEETLNDTSGSP
KMFAQDTVCAPFPQRATPKVTSQGNPSIQLEELGSRVESLKLSDSYLDPIKSEHDCYPTS
SLNKVIPDLNLRNCLALGGSTSPTSVIKFLLAGSKQATLGAKPDHQEAFEATANQQEVSD
TTSFLGQAFGAIPHQWELPGADPVHGEALGETPDLPEIPGAIPVQGEVFGTILDQQETLG
MSGSVVPDLPVFLPVPPNPIATFNAPSKWPEPQSTVSYGLAVQGAIQILPLGSGHTPQSS
SNSEKNSLPPVMAISNVENEKQVHISFLPANTQGFPLAPERGLFHASLGIAQLSQAGPSK
SDRGSSQVSVTSTVHVVNTTVVTMPVPMVSTSSSSYTTLLPTLEKKKRKRCGVCEPCQQK
TNCGECTYCKNRKNSHQICKKRKCEELKKKPSVVVPLEVIKENKRPQREKKPKVLKADFD
NKPVNGPKSESMDYSRCGHGEEQKLELNPHTVENVTKNEDSMTGIEVEKWTQNKKSQLTD
HVKGDFSANVPEAEKSKNSEVDKKRTKSPKLFVQTVRNGIKHVHCLPAETNVSFKKFNIE
EFGKTLENNSYKFLKDTANHKNAMSSVATDMSCDHLKGRSNVLVFQQPGFNCSSIPHSSH
SIINHHASIHNEGDQPKTPENIPSKEPKDGSPVQPSLLSLMKDRRLTLEQVVAIEALTQL
SEAPSENSSPSKSEKDEESEQRTASLLNSCKAILYTVRKDLQDPNLQGEPPKLNHCPSLE
KQSSCNTVVFNGQTTTLSNSHINSATNQASTKSHEYSKVTNSLSLFIPKSNSSKIDTNKS
IAQGIITLDNCSNDLHQLPPRNNEVEYCNQLLDSSKKLDSDDLSCQDATHTQIEEDVATQ
LTQLASIIKINYIKPEDKKVESTPTSLVTCNVQQKYNQEKGTIQQKPPSSVHNNHGSSLT
KQKNPTQKKTKSTPSRDRRKKKPTVVSYQENDRQKWEKLSYMYGTICDIWIASKFQNFGQ
FCPHDFPTVFGKISSSTKIWKPLAQTRSIMQPKTVFPPLTQIKLQRYPESAEEKVKVEPL
DSLSLFHLKTESNGKAFTDKAYNSQVQLTVNANQKAHPLTQPSSPPNQCANVMAGDDQIR
FQQVVKEQLMHQRLPTLPGISHETPLPESALTLRNVNVVCSGGITVVSTKSEEEVCSSSF
GTSEFSTVDSAQKNFNDYAMNFFTNPTKNLVSITKDSELPTCSCLDRVIQKDKGPYYTHL
GAGPSVAAVREIMENRYGQKGNAIRIEIVVYTGKEGKSSHGCPIAKWVLRRSSDEEKVLC
LVRQRTGHHCPTAVMVVLIMVWDGIPLPMADRLYTELTENLKSYNGHPTDRRCTLNENRT
CTCQGIDPETCGASFSFGCSWSMYFNGCKFGRSPSPRRFRIDPSSPLHEKNLEDNLQSLA
TRLAPIYKQYAPVAYQNQVEYENVARECRLGSKEGRPFSGVTACLDFCAHPHRDIHNMNN
GSTVVCTLTREDNRSLGVIPQDEQLHVLPLYKLSDTDEFGSKEGMEAKIKSGAIEVLAPR
RKKRTCFTQPVPRSGKKRAAMMTEVLAHKIRAVEKKPIPRIKRKNNSTTTNNSKPSSLPT
LGSNTETVQPEVKSETEPHFILKSSDNTKTYSLMPSAPHPVKEASPGFSWSPKTASATPA
PLKNDATASCGFSERSSTPHCTMPSGRLSGANAAAADGPGISQLGEVAPLPTLSAPVMEP
LINSEPSTGVTEPLTPHQPNHQPSFLTSPQDLASSPMEEDEQHSEADEPPSDEPLSDDPL
SPAEEKLPHIDEYWSDSEHIFLDANIGGVAIAPAHGSVLIECARRELHATTPVEHPNRNH
PTRLSLVFYQHKNLNKPQHGFELNKIKFEAKEAKNKKMKASEQKDQAANEGPEQSSEVNE
LNQIPSHKALTLTHDNVVTVSPYALTHVAGPYNHWV

Sequence length

2136

Interactions

View interactions

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Autism spectrum disorder	Autism Spectrum Disorders	rs724159978, rs75184679, rs119103221, rs9332964, rs121912562, rs1594344233, rs727504317, rs111033204, rs1801086, rs587784464, rs724159948, rs764659822, rs794727977, rs796052733, rs796052728 View all (51 more)	25290267
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	23938174

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Source
Unknown
Gout	Gout	GWAS
Diabetes	Diabetes	GWAS
Metabolic Syndrome	Metabolic Syndrome	GWAS

Show/Hide Text Mining Associations (99)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Stimulate	30622117
Adenocarcinoma of Lung	Associate	30735628, 31386689
Alzheimer Disease	Stimulate	24012631
Alzheimer Disease	Associate	29875879
Arthritis Rheumatoid	Associate	37993905
Asthma	Associate	26684294
Atherosclerosis	Associate	32981917
Atrial Fibrillation	Associate	37620966
Autism Spectrum Disorder	Associate	24448211
Autistic Disorder	Associate	25290267
Bipolar Disorder	Associate	25476119
Breast Neoplasms	Associate	25735355, 26207381, 29938218, 30537986, 35440669, 37740473
Calcinosis	Associate	32981917
Calcinosis Cutis	Associate	30306561
Carcinogenesis	Associate	26462176, 27225590, 32390600, 32740973, 33870509, 34731191, 35835915, 37020036
Carcinoma Basal Cell	Associate	33928395, 35440669
Carcinoma Ductal	Associate	33667646
Carcinoma Hepatocellular	Associate	31153371, 37181808, 37266610
Carcinoma Hepatocellular	Stimulate	33970549
Carcinoma in Situ	Associate	24292451
Carcinoma Non Small Cell Lung	Associate	36593050
Carcinoma Pancreatic Ductal	Inhibit	33870509
Carcinoma Pancreatic Ductal	Associate	38044421
Carcinoma Renal Cell	Inhibit	26165803
Carcinoma Renal Cell	Associate	37584255
Carcinoma Squamous Cell	Associate	26776158, 29617660
Carcinoma Squamous Cell	Stimulate	30622117
Cholangiocarcinoma	Stimulate	32740973
Cholangiocarcinoma	Associate	37932819
Colonic Neoplasms	Associate	35395805
Colorectal Neoplasms	Associate	22320381, 25557833, 26816554, 27259240, 27977763, 29715584, 30651599, 32887024, 35395805, 35798829, 35858918, 36966142, 37612734
Depressive Disorder	Associate	30651599
Diabetes Mellitus Type 2	Associate	26356709, 27477082
Diffuse Intrinsic Pontine Glioma	Associate	24894482
DNA Virus Infections	Associate	35395805
Down Syndrome	Associate	25701644, 29069286
Drug Related Side Effects and Adverse Reactions	Associate	31278917
Endometrial Neoplasms	Associate	28349832, 30849641
Endometrial Neoplasms	Inhibit	34731191
Endometriosis	Associate	30130982
Endometriosis	Inhibit	35489280
Ependymoma	Associate	28228863
Esophageal Squamous Cell Carcinoma	Associate	27050164
Glioblastoma	Associate	25284789, 27346347, 31278917, 33142244
Glioma	Associate	28341638, 31278917, 32483272, 34628789
Hepatomegaly	Associate	35835915
HIV Infections	Associate	33045438
Hypoxia	Stimulate	24835990, 28808304, 31935962, 35942521
Hypoxia	Associate	25517638, 37020036
Hypoxia Brain	Associate	24835990, 35942521
Idiopathic Pulmonary Fibrosis	Associate	28294974
Infertility	Associate	30130982
Inflammation	Associate	29138803, 31935962
Insulin Resistance	Associate	27477082
Kidney Neoplasms	Associate	30411496
Leiomyoma	Associate	25057885, 30058675, 34644730
Leukemia	Associate	23818607, 28982308, 29402726
Leukemia Lymphocytic Chronic B Cell	Inhibit	27980696
Leukemia Myeloid Acute	Associate	22976956, 23818607, 28982308, 29402726
Leukemia Myeloid Acute	Inhibit	32209730
Leukemia Myeloid Acute	Stimulate	36371552
Leukemia Myelomonocytic Chronic	Associate	27164004
Lung Neoplasms	Inhibit	27346347
Lung Neoplasms	Associate	29938218, 30622117, 30987976, 31623662
Lymphatic Metastasis	Inhibit	28349832
Lymphoma	Inhibit	27225590
Lymphoma Non Hodgkin	Associate	27225590
Medulloblastoma	Associate	28228863
Melanoma	Associate	35798829
Nasal Septal Perforation	Inhibit	30075814
Nasopharyngeal Carcinoma	Associate	30075814
Neoplasm Metastasis	Inhibit	24939750, 25735355, 26462176
Neoplasm Metastasis	Associate	27014907, 29512746, 30735628
Neoplasms	Associate	19420352, 22320381, 24096364, 25089631, 26472283, 26973719, 27164004, 27225590, 27346347, 28808304, 29715584, 29891505, 30045709, 30239619, 30622117 View all (11 more)
Neoplasms	Inhibit	24939750, 25557833, 25735355, 26165803, 27014907, 28341638, 28349832, 29138803, 29512746, 29938218, 30075814, 30431097, 30735628, 31820855, 35858918, 37266610 View all (1 more)
Neoplasms Germ Cell and Embryonal	Associate	24386123
Neuroblastoma	Associate	24835990, 35942521, 37347215
Neuroendocrine Tumors	Associate	30045709
Non alcoholic Fatty Liver Disease	Associate	26356709
Pancreatitis	Associate	33870509
Papillomavirus Infections	Associate	36692670
Parathyroid Neoplasms	Associate	26973719
Parkinson Disease	Associate	24325350
Precancerous Conditions	Inhibit	33870509
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	22675565
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Stimulate	37993905
Prostatic Neoplasms	Associate	27014907, 27457352, 34844636, 37430206
Psychotic Disorders	Stimulate	22948384
Schizophrenia	Associate	25476119
Scleroderma Systemic	Associate	35183246
Seminoma	Associate	28218476
Status Asthmaticus	Associate	26684294
Stomach Neoplasms	Associate	26462176, 29512746, 30431097, 32017451, 36195596
Stomach Neoplasms	Inhibit	27225590
Teratoma	Associate	32587369
Thyroid Neoplasms	Associate	37020036
Triple Negative Breast Neoplasms	Associate	29891505, 35440669, 38356412
Uterine Cervical Neoplasms	Associate	31820855, 36692670
Uterine Diseases	Associate	34731191

TET1 (tet methylcytosine dioxygenase 1)