Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	80310
Gene name Gene Name - the full gene name approved by the HGNC.	Platelet derived growth factor D
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PDGFD
Synonyms (NCBI Gene) Gene synonyms aliases	IEGF, MSTP036, SCDGF-B, SCDGFB
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q22.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a core motif of eight cysteines, seven of which are f

Show/Hide all(115)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030746	hsa-miR-21-5p	Microarray	18591254
MIRT053656	hsa-miR-145-5p	Microarray	22942087
MIRT756188	hsa-miR-429	Western blotting, qRT-PCR	35509844
MIRT1221212	hsa-miR-1257	CLIP-seq
MIRT1221213	hsa-miR-125a-3p	CLIP-seq
MIRT1221214	hsa-miR-125a-5p	CLIP-seq
MIRT1221215	hsa-miR-125b	CLIP-seq
MIRT1221216	hsa-miR-1265	CLIP-seq
MIRT1221217	hsa-miR-3132	CLIP-seq
MIRT1221218	hsa-miR-3200-5p	CLIP-seq
MIRT1221219	hsa-miR-4319	CLIP-seq
MIRT1221220	hsa-miR-4427	CLIP-seq
MIRT1221221	hsa-miR-4639-3p	CLIP-seq
MIRT1221222	hsa-miR-4650-3p	CLIP-seq
MIRT1221223	hsa-miR-4680-3p	CLIP-seq
MIRT1221224	hsa-miR-4732-3p	CLIP-seq
MIRT1221225	hsa-miR-4756-3p	CLIP-seq
MIRT1221226	hsa-miR-4764-5p	CLIP-seq
MIRT1221227	hsa-miR-4773	CLIP-seq
MIRT1221228	hsa-miR-610	CLIP-seq
MIRT1221229	hsa-miR-670	CLIP-seq
MIRT2063840	hsa-miR-224	CLIP-seq
MIRT1221217	hsa-miR-3132	CLIP-seq
MIRT2063841	hsa-miR-3185	CLIP-seq
MIRT2063842	hsa-miR-371-5p	CLIP-seq
MIRT2063843	hsa-miR-4420	CLIP-seq
MIRT1221221	hsa-miR-4639-3p	CLIP-seq
MIRT1221222	hsa-miR-4650-3p	CLIP-seq
MIRT1221227	hsa-miR-4773	CLIP-seq
MIRT2439251	hsa-miR-3148	CLIP-seq
MIRT2439252	hsa-miR-331-5p	CLIP-seq
MIRT2439253	hsa-miR-4678	CLIP-seq
MIRT2439251	hsa-miR-3148	CLIP-seq
MIRT2439252	hsa-miR-331-5p	CLIP-seq
MIRT2439253	hsa-miR-4678	CLIP-seq
MIRT2590104	hsa-miR-103b	CLIP-seq
MIRT2590105	hsa-miR-1182	CLIP-seq
MIRT2590106	hsa-miR-1206	CLIP-seq
MIRT2590107	hsa-miR-1229	CLIP-seq
MIRT2590108	hsa-miR-1244	CLIP-seq
MIRT2590109	hsa-miR-138	CLIP-seq
MIRT2590110	hsa-miR-3117-3p	CLIP-seq
MIRT2590111	hsa-miR-3169	CLIP-seq
MIRT2590112	hsa-miR-325	CLIP-seq
MIRT2590113	hsa-miR-33a	CLIP-seq
MIRT2590114	hsa-miR-33b	CLIP-seq
MIRT2590115	hsa-miR-3620	CLIP-seq
MIRT2590116	hsa-miR-3653	CLIP-seq
MIRT2590117	hsa-miR-3658	CLIP-seq
MIRT2590118	hsa-miR-3672	CLIP-seq
MIRT2590119	hsa-miR-4317	CLIP-seq
MIRT2590120	hsa-miR-4422	CLIP-seq
MIRT2590121	hsa-miR-4496	CLIP-seq
MIRT2590122	hsa-miR-4509	CLIP-seq
MIRT2590123	hsa-miR-4511	CLIP-seq
MIRT2590124	hsa-miR-4667-3p	CLIP-seq
MIRT2590125	hsa-miR-4740-5p	CLIP-seq
MIRT2590126	hsa-miR-4759	CLIP-seq
MIRT1221227	hsa-miR-4773	CLIP-seq
MIRT2590127	hsa-miR-512-5p	CLIP-seq
MIRT2590128	hsa-miR-545	CLIP-seq
MIRT2590129	hsa-miR-548b-3p	CLIP-seq
MIRT2590130	hsa-miR-548m	CLIP-seq
MIRT2590131	hsa-miR-549	CLIP-seq
MIRT2590132	hsa-miR-581	CLIP-seq
MIRT2590133	hsa-miR-659	CLIP-seq
MIRT2590134	hsa-miR-890	CLIP-seq
MIRT2590135	hsa-miR-892b	CLIP-seq
MIRT2590104	hsa-miR-103b	CLIP-seq
MIRT2590105	hsa-miR-1182	CLIP-seq
MIRT2590106	hsa-miR-1206	CLIP-seq
MIRT2590107	hsa-miR-1229	CLIP-seq
MIRT2590108	hsa-miR-1244	CLIP-seq
MIRT2590109	hsa-miR-138	CLIP-seq
MIRT2687454	hsa-miR-1827	CLIP-seq
MIRT2590110	hsa-miR-3117-3p	CLIP-seq
MIRT2687455	hsa-miR-3155	CLIP-seq
MIRT2687456	hsa-miR-3155b	CLIP-seq
MIRT2590111	hsa-miR-3169	CLIP-seq
MIRT2687457	hsa-miR-3173-3p	CLIP-seq
MIRT2687458	hsa-miR-323b-5p	CLIP-seq
MIRT2590112	hsa-miR-325	CLIP-seq
MIRT2590113	hsa-miR-33a	CLIP-seq
MIRT2590114	hsa-miR-33b	CLIP-seq
MIRT2687459	hsa-miR-3612	CLIP-seq
MIRT2590115	hsa-miR-3620	CLIP-seq
MIRT2590116	hsa-miR-3653	CLIP-seq
MIRT2590117	hsa-miR-3658	CLIP-seq
MIRT2590118	hsa-miR-3672	CLIP-seq
MIRT2590119	hsa-miR-4317	CLIP-seq
MIRT2687460	hsa-miR-4328	CLIP-seq
MIRT2590120	hsa-miR-4422	CLIP-seq
MIRT2687461	hsa-miR-4495	CLIP-seq
MIRT2590121	hsa-miR-4496	CLIP-seq
MIRT2590122	hsa-miR-4509	CLIP-seq
MIRT2590123	hsa-miR-4511	CLIP-seq
MIRT2590124	hsa-miR-4667-3p	CLIP-seq
MIRT2687462	hsa-miR-4695-5p	CLIP-seq
MIRT2687463	hsa-miR-4703-3p	CLIP-seq
MIRT2590125	hsa-miR-4740-5p	CLIP-seq
MIRT2590126	hsa-miR-4759	CLIP-seq
MIRT1221227	hsa-miR-4773	CLIP-seq
MIRT2687464	hsa-miR-4799-5p	CLIP-seq
MIRT2687465	hsa-miR-484	CLIP-seq
MIRT2590127	hsa-miR-512-5p	CLIP-seq
MIRT2590128	hsa-miR-545	CLIP-seq
MIRT2590129	hsa-miR-548b-3p	CLIP-seq
MIRT2590130	hsa-miR-548m	CLIP-seq
MIRT2590131	hsa-miR-549	CLIP-seq
MIRT2590132	hsa-miR-581	CLIP-seq
MIRT2687466	hsa-miR-582-3p	CLIP-seq
MIRT2687467	hsa-miR-650	CLIP-seq
MIRT2590133	hsa-miR-659	CLIP-seq
MIRT2590134	hsa-miR-890	CLIP-seq
MIRT2590135	hsa-miR-892b	CLIP-seq

Show/Hide all(24)

GO ID	Ontology	Definition	Evidence
GO:0000139	Component	Golgi membrane	TAS
GO:0005161	Function	Platelet-derived growth factor receptor binding	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0008083	Function	Growth factor activity	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0016020	Component	Membrane	IEA
GO:0030335	Process	Positive regulation of cell migration	IBA
GO:0036120	Process	Cellular response to platelet-derived growth factor stimulus	IEA
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	IBA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IEA
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IEA
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IBA
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IBA
GO:0071230	Process	Cellular response to amino acid stimulus	IEA
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEA
GO:0071673	Process	Positive regulation of smooth muscle cell chemotaxis	IEA
GO:0072126	Process	Positive regulation of glomerular mesangial cell proliferation	IEA
GO:2000439	Process	Positive regulation of monocyte extravasation	IEA

MIM	HGNC	e!Ensembl
609673	30620	ENSG00000170962

Protein

UniProt ID

Q9GZP0

Protein name

Platelet-derived growth factor D (PDGF-D) (Iris-expressed growth factor) (Spinal cord-derived growth factor B) (SCDGF-B) [Cleaved into: Platelet-derived growth factor D, latent form (PDGFD latent form); Platelet-derived growth factor D, receptor-binding f

Protein function

Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Plays an important role in wound healing. Induces

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00431	CUB	53 → 167	CUB domain	Domain
PF00341	PDGF	272 → 362	PDGF/VEGF domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed at high levels in the heart, pancreas, adrenal gland and ovary and at low levels in placenta, liver, kidney, prostate, testis, small intestine, spleen and colon. In the kidney, expressed by the visceral epithelial cells of th

Sequence

MHRLIFVYTLICANFCSCRDTSATPQSASIKALRNANLRRDESNHLTDLYRRDETIQVKG
NGYVQSPRFPNSYPRNLLLTWRLHSQENTRIQLVFDNQFGLEEAENDICRYDFVEVEDIS
ETSTIIRGRWCGHKEVPPRIKSRTNQIKITFKSDDYFVAKPGFKIYYSLLEDFQPAAASE
TNWESVTSSISGVSYNSPSVTDPTLIADALDKKIAEFDTVEDLLKYFNPESWQEDLENMY
LDTPRYRGRSYHDRKSKVDLDRLNDDAKRYSCTPRNYSVNIREELKLANVVFFPRCLLVQ
RCGGNCGCGTVNWRSCTCNSGKTVKKYHEVLQFEPGHIKRRGRAKTMALVDIQLDHHERC
DCICSSRPPR

Sequence length

370

Interactions

View interactions

	KEGG		Reactome
	EGFR tyrosine kinase inhibitor resistance MAPK signaling pathway Ras signaling pathway Rap1 signaling pathway Calcium signaling pathway Phospholipase D signaling pathway PI3K-Akt signaling pathway Focal adhesion Gap junction Regulation of actin cytoskeleton Prostate cancer Melanoma Choline metabolism in cancer		Signaling by PDGF

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Dementia	Dementia	N/A	N/A	GWAS
Pulmonary arterial hypertension	pulmonary arterial hypertension	N/A	N/A	GenCC

Show/Hide Text Mining Associations (46)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acidosis	Associate	26157007
Acne Vulgaris	Associate	37018476
Adenocarcinoma	Associate	29961751, 32869505
Adrenal Gland Neoplasms	Associate	35568735
Airway Obstruction	Associate	35568735
Arthritis Rheumatoid	Associate	16508943, 24989895
Ascites	Stimulate	22471482
Atherosclerosis	Associate	26362023
Carcinogenesis	Associate	26157007
Carcinoma Hepatocellular	Associate	24158561, 25760076, 36308081, 37253627
Carcinoma Ovarian Epithelial	Associate	29240605
Carotid Artery Injuries	Associate	18187181
Cerebral Hemorrhage	Associate	22289441
Colorectal Neoplasms	Associate	29024195
Coronary Artery Disease	Associate	24573017, 35246263
Dermatofibrosarcoma	Associate	29955147, 30014607, 33762682, 34256767, 39956270
Endometrial Neoplasms	Stimulate	24870786
Esophageal Neoplasms	Associate	34329340
Glioma	Associate	40530904
Hereditary Breast and Ovarian Cancer Syndrome	Associate	30014607
Hypertension	Associate	22289441
Inflammation	Associate	22289441
Intracranial Thrombosis	Associate	22289441
Lymphatic Metastasis	Stimulate	22471482, 29240605
Lymphoma Large B Cell Diffuse	Associate	32186759
Meningioma	Stimulate	25333347
Mesothelioma	Associate	27605433
Myocardial Infarction	Associate	27585990
Neoplasm Metastasis	Associate	18403754, 22471482, 24870786
Neoplasm Metastasis	Inhibit	33524869
Neoplasms	Associate	17135416, 18403754, 18758297, 24870786, 27605433, 28392480, 29932922, 30014607, 34674640, 34858395, 39956270, 40181449, 40530904
Neurilemmoma	Stimulate	25333347
Neurocytoma	Associate	17135416
Non Muscle Invasive Bladder Neoplasms	Associate	33465047
Osteoarthritis	Associate	16508943
Ovarian Neoplasms	Associate	22471482
Polycystic Ovary Syndrome	Associate	29734187
Prostatic Neoplasms	Associate	14996732, 18339874, 18403754, 19544444, 29024195
Prostatitis	Associate	18339874
Pulmonary Arterial Hypertension	Associate	33187088, 33971972
Radiation Injuries	Associate	24512807
Radiculopathy	Associate	28260009
Renal Insufficiency Chronic	Associate	18187181, 34946851
Stomach Neoplasms	Associate	17601708
Stroke	Associate	22289441
Urinary Bladder Neoplasms	Associate	34858395, 36245371, 36357874

PDGFD (platelet derived growth factor D)