Gene Gene information from NCBI Gene database.
Entrez ID 8031
Gene name Nuclear receptor coactivator 4
Gene symbol NCOA4
Synonyms (NCBI Gene)
ARA70ELE1PTC3RFG
Chromosome 10
Chromosome location 10q11.22
Summary This gene encodes an androgen receptor coactivator. The encoded protein interacts with the androgen receptor in a ligand-dependent manner to enhance its transcriptional activity. Chromosomal translocations between this gene and the ret tyrosine kinase gen
miRNA miRNA information provided by mirtarbase database.
549
miRTarBase ID miRNA Experiments Reference
MIRT044019 hsa-miR-365a-3p CLASH 23622248
MIRT041830 hsa-miR-484 CLASH 23622248
MIRT038845 hsa-miR-93-3p CLASH 23622248
MIRT328260 hsa-miR-6507-5p PAR-CLIP 21572407
MIRT328258 hsa-miR-3668 PAR-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
21
GO ID Ontology Definition Evidence Reference
GO:0003713 Function Transcription coactivator activity IEA
GO:0003713 Function Transcription coactivator activity TAS 8643607
GO:0005515 Function Protein binding IPI 25327288, 28514442, 32296183, 32814053, 33961781
GO:0005634 Component Nucleus IEA
GO:0005634 Component Nucleus TAS 8643607
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601984 7671 ENSG00000266412
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q13772
Protein name Nuclear receptor coactivator 4 (NCoA-4) (Androgen receptor coactivator 70 kDa protein) (70 kDa AR-activator) (70 kDa androgen receptor coactivator) (Androgen receptor-associated protein of 70 kDa) (Ferritin cargo receptor NCOA4) (Ret-activating protein EL
Protein function Cargo receptor for the autophagic turnover of the iron-binding ferritin complex, playing a central role in iron homeostasis (PubMed:25327288, PubMed:26436293). Acts as an adapter for delivery of ferritin to lysosomes and autophagic degradation o
PDB 1T5Z , 8QU9
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12489 ARA70 34 147 Nuclear coactivator Family
PF12489 ARA70 199 328 Nuclear coactivator Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Also detected in adipose tissues and in different cell lines. Isoform Beta is only expressed in testis.
Sequence
MNTFQDQSGSSSNREPLLRCSDARRDLELAIGGVLRAEQQIKDNLREVKAQIHSCISRHL
ECLRSREVWLYEQVDLIYQLKEETLQQQAQQLYSLLGQFNCLTHQLECTQNKDLANQVSV
CLERLGSLTLKPEDSTVLLFEADTITL
RQTITTFGSLKTIQIPEHLMAHASSANIGPFLE
KRGCISMPEQKSASGIVAVPFSEWLLGSKPASGYQAPYIPSTDPQDWLTQKQTLENSQTS
SRACNFFNNVGGNLKGLENWLLKSEKSSYQKCNSHSTTSSFSIEMEKVGDQELPDQDEMD
LSDWLVTPQESHKLRKPENGSRETSEKF
KLLFQSYNVNDWLVKTDSCTNCQGNQPKGVEI
ENLGNLKCLNDHLEAKKPLSTPSMVTEDWLVQNHQDPCKVEEVCRANEPCTSFAECVCDE
NCEKEALYKWLLKKEGKDKNGMPVEPKPEPEKHKDSLNMWLCPRKEVIEQTKAPKAMTPS
RIADSFQVIKNSPLSEWLIRPPYKEGSPKEVPGTEDRAGKQKFKSPMNTSWCSFNTADWV
LPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLK
VDKEKWLYRTPLQM
Sequence length 614
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  Ferroptosis
Pathways in cancer
Thyroid cancer
 
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
16
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia Benign rs117257055 RCV005904596
Cervical cancer Benign rs117257055 RCV005904600
Cholangiocarcinoma Benign rs117257055 RCV005904608
Clear cell carcinoma of kidney Benign rs117257055 RCV005904601
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 21261984
Adenoma Associate 32638211
Adenomatous Polyposis Coli Associate 9916927
Androgen Insensitivity Syndrome Associate 9576916
Brain Injuries Traumatic Associate 37979398
Carcinogenesis Associate 30467698
Carcinoma Intraductal Noninfiltrating Associate 29443014, 31162284, 32661669, 33991527, 34985683
Carcinoma Pancreatic Ductal Associate 31162284
Carcinoma Papillary Associate 10646883
Carcinoma Renal Cell Associate 32688345, 33402128, 34370716