Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8022
Gene name Gene Name - the full gene name approved by the HGNC.
LIM homeobox 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LHX3
Synonyms (NCBI Gene) Gene synonyms aliases
CPHD3, LIM3, M2-LHX3
Disease Acronyms (UniProt) Disease acronyms from UniProt database
CPHD3
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9q34.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of a large family of proteins which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein is a transcription factor that is required for pituitary development and motor neuron specification. Mutat
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs104894117 T>C Pathogenic Coding sequence variant, missense variant
rs137854503 G>A Pathogenic Coding sequence variant, missense variant
rs137854504 GC>AGGA Pathogenic Coding sequence variant, frameshift variant
rs137854505 C>T Pathogenic Coding sequence variant, stop gained
rs137854506 T>A Pathogenic Coding sequence variant, stop gained
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1108993 hsa-miR-4761-5p CLIP-seq
MIRT1108994 hsa-miR-545 CLIP-seq
MIRT1108995 hsa-miR-1207-5p CLIP-seq
MIRT1108996 hsa-miR-125a-5p CLIP-seq
MIRT1108997 hsa-miR-125b CLIP-seq
Transcription factors
Transcription factor Regulation Reference
SOX2 Activation 18407919
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA 21873635
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600577 6595 ENSG00000107187
Protein
UniProt ID Q9UBR4
Protein name LIM/homeobox protein Lhx3 (LIM homeobox protein 3)
Protein function Transcription factor. Recognizes and binds to the consensus sequence motif 5'-AATTAATTA-3' in the regulatory elements of target genes, such as glycoprotein hormones alpha chain CGA and visual system homeobox CHX10, positively modulating transcri
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00412 LIM 31 86 LIM domain Domain
PF00412 LIM 90 149 LIM domain Domain
PF00046 Homeodomain 158 214 Homeodomain Domain
Sequence
MLLETGLERDRARPGAAAVCTLGGTREIPLCAGCDQHILDRFILKALDRHWHSKCLKCSD
CHTPLAERCFSRGESVYCKDDFFKRF
GTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVV
CKRQLATGDEFYLMEDSRLVCKADYETAK
QREAEATAKRPRTTITAKQLETLKSAYNTSP
KPARHVREQLSSETGLDMRVVQVWFQNRRAKEKR
LKKDAGRQRWGQYFRNMKRSRGGSKS
DKDSVQEGQDSDAEVSFPDEPSLAEMGPANGLYGSLGEPTQALGRPSGALGNFSLEHGGL
AGPEQYRELRPGSPYGVPPSPAAPQSLPGPQPLLSSLVYPDTSLGLVPSGAPGGPPPMRV
LAGNGPSSDLSTGSSGGYPDFPASPASWLDEVDHAQF
Sequence length 397
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Atrial fibrillation Atrial Fibrillation rs120074192, rs121908590, rs121908593, rs121434558, rs587776851, rs387906612, rs387906613, rs387906614, rs387906615, rs199472687, rs199472705, rs199473324, rs587777336, rs587777339, rs587777557
View all (6 more)
29892015, 30061737
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
Hearing loss Sensorineural Hearing Loss (disorder) rs267607135, rs267606855, rs779841884, rs267606854, rs28942097, rs121908073, rs121908076, rs74315289, rs121908144, rs111033313, rs74315437, rs121908348, rs121908349, rs121908350, rs397515359
View all (184 more)
18407919
Hypothyroidism Hypothyroidism due to deficient transcription factors involved in pituitary development or function, Secondary hypothyroidism rs869320723, rs121908862, rs121908863, rs121908865, rs121908866, rs121908867, rs121908870, rs121908871, rs121908872, rs2140110277, rs121908881, rs121908884, rs121908885, rs786205080, rs1586182912
View all (22 more)
Unknown
Disease term Disease name Evidence References Source
Paroxysmal atrial fibrillation Paroxysmal atrial fibrillation 29892015, 30061737 ClinVar
Non-acquired combined pituitary hormone deficiency-sensorineural hearing loss-spine abnormalities syndrome non-acquired combined pituitary hormone deficiency with spine abnormalities GenCC
Lung adenocarcinoma Lung adenocarcinoma Validation that loss of Tgfbr2 results in more aggressive and T cell-excluded KP lung tumors GWAS, CBGDA
Diabetes Diabetes GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 28731174
Adenocarcinoma of Lung Associate 28731174
Breast Neoplasms Associate 19153192
Carcinoma Hepatocellular Associate 31306102
Carcinoma Non Small Cell Lung Associate 28731174
Cervical Vertebral Dysplasia Stimulate 28302169
Chromosome Aberrations Associate 34124982
Combined Pituitary Hormone Deficiency Associate 22286346, 28302169, 29261175
Combined Pituitary Hormone Deficiency Inhibit 28302169
Developmental Disabilities Associate 22286346