Gene Gene information from NCBI Gene database.
Entrez ID 80219
Gene name Coenzyme Q10B
Gene symbol COQ10B
Synonyms (NCBI Gene)
-
Chromosome 2
Chromosome location 2q33.1
miRNA miRNA information provided by mirtarbase database.
501
miRTarBase ID miRNA Experiments Reference
MIRT027526 hsa-miR-98-5p Microarray 19088304
MIRT714898 hsa-miR-1323 HITS-CLIP 19536157
MIRT714897 hsa-miR-548o-3p HITS-CLIP 19536157
MIRT714896 hsa-miR-764 HITS-CLIP 19536157
MIRT714895 hsa-miR-371b-5p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8
GO ID Ontology Definition Evidence Reference
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IBA
GO:0005739 Component Mitochondrion IEA
GO:0005743 Component Mitochondrial inner membrane IEA
GO:0005743 Component Mitochondrial inner membrane TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
620737 25819 ENSG00000115520
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9H8M1
Protein name Coenzyme Q-binding protein COQ10 homolog B, mitochondrial
Protein function Required for the function of coenzyme Q in the respiratory chain. May serve as a chaperone or may be involved in the transport of Q6 from its site of synthesis to the catalytic sites of the respiratory complexes (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03364 Polyketide_cyc 84 213 Polyketide cyclase / dehydrase and lipid transport Family
Sequence
MAARTGHTALRRVVSGCRPKSATAAGAQAPVRNGRYLASCGILMSRTLPLHTSILPKEIC
ARTFFKITAPLINKRKEYSERRILGYSMQEMYDVVSGVEDYKHFVPWCKKSDVISKRSGY
CKTRLEIGFPPVLERYTSVVTLVKPHLVKASCTDGRLFNHLETIWRFSPGLPGYPRTCTL
DFSISFEFRSLLHSQLATLFFDEVVKQMVAAFE
RRACKLYGPETNIPRELMLHEVHHT
Sequence length 238
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Respiratory electron transport