Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
80219
Gene name Gene Name - the full gene name approved by the HGNC.
Coenzyme Q10B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
COQ10B
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q33.1
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT027526 hsa-miR-98-5p Microarray 19088304
MIRT714898 hsa-miR-1323 HITS-CLIP 19536157
MIRT714897 hsa-miR-548o-3p HITS-CLIP 19536157
MIRT714896 hsa-miR-764 HITS-CLIP 19536157
MIRT714895 hsa-miR-371b-5p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005739 Component Mitochondrion IBA 21873635
GO:0005743 Component Mitochondrial inner membrane IEA
GO:0006744 Process Ubiquinone biosynthetic process IBA 21873635
GO:0045333 Process Cellular respiration IBA 21873635
GO:0048039 Function Ubiquinone binding IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
620737 25819 ENSG00000115520
Protein
UniProt ID Q9H8M1
Protein name Coenzyme Q-binding protein COQ10 homolog B, mitochondrial
Protein function Required for the function of coenzyme Q in the respiratory chain. May serve as a chaperone or may be involved in the transport of Q6 from its site of synthesis to the catalytic sites of the respiratory complexes (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03364 Polyketide_cyc 84 213 Polyketide cyclase / dehydrase and lipid transport Family
Sequence
MAARTGHTALRRVVSGCRPKSATAAGAQAPVRNGRYLASCGILMSRTLPLHTSILPKEIC
ARTFFKITAPLINKRKEYSERRILGYSMQEMYDVVSGVEDYKHFVPWCKKSDVISKRSGY
CKTRLEIGFPPVLERYTSVVTLVKPHLVKASCTDGRLFNHLETIWRFSPGLPGYPRTCTL
DFSISFEFRSLLHSQLATLFFDEVVKQMVAAFE
RRACKLYGPETNIPRELMLHEVHHT
Sequence length 238
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Respiratory electron transport
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)
31268507
Associations from Text Mining
Disease Name Relationship Type References
Hypertension Pregnancy Induced Inhibit 39503530