Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
80198
Gene name Gene Name - the full gene name approved by the HGNC.
MUS81 structure-specific endonuclease subunit
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MUS81
Synonyms (NCBI Gene) Gene synonyms aliases
SLX3
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q13.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a structure-specific endonuclease which belongs to the XPF/MUS81 endonuclease family and plays a critical role in the resolution of recombination intermediates during DNA repair after inter-strand cross-links, replication fork collapse,
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT020863 hsa-miR-155-5p Proteomics 18668040
MIRT2276981 hsa-miR-548aa CLIP-seq
MIRT2276982 hsa-miR-548ac CLIP-seq
MIRT2276983 hsa-miR-548ae CLIP-seq
MIRT2276984 hsa-miR-548aj CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000712 Process Resolution of meiotic recombination intermediates IBA 21873635
GO:0000727 Process Double-strand break repair via break-induced replication IBA 21873635
GO:0000737 Process DNA catabolic process, endonucleolytic IMP 23361013
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 12686547, 17289582, 19017809, 19596235, 19596236, 22551069, 24012755, 24733841, 29892012, 32296183
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606591 29814 ENSG00000172732
Protein
UniProt ID Q96NY9
Protein name Structure-specific endonuclease subunit MUS81 (EC 3.1.22.-) (Crossover junction endonuclease MUS81) (MUS81 endonuclease homolog)
Protein function Catalytic subunit of two functionally distinct, structure-specific, heterodimeric DNA endonucleases MUS81-EME1 and MUS81-EME2 that are involved in the maintenance of genome stability (PubMed:11741546, PubMed:12374758, PubMed:12686547, PubMed:127
PDB 2MC3 , 2ZIX , 4P0P , 4P0Q , 4P0R , 4P0S , 6VWB , 7BU5 , 7F6L , 9F98 , 9F99 , 9F9A , 9F9K , 9F9L , 9F9M
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02732 ERCC4 273 415 ERCC4 domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:11741546}.
Sequence
MAAPVRLGRKRPLPACPNPLFVRWLTEWRDEATRSRRRTRFVFQKALRSLRRYPLPLRSG
KEAKILQHFGDGLCRMLDERLQRHRTSGGDHAPDSPSGENSPAPQGRLAEVQDSSMPVPA
QPKAGGSGSYWPARHSGARVILLVLYREHLNPNGHHFLTKEELLQRCAQKSPRVAPGSAR
PWPALRSLLHRNLVLRTHQPARYSLTPEGLELAQKLAESEGLSLLNVGIGPKEPPGEETA
VPGAASAELASEAGVQQQPLELRPGEYRVLLCVDIGETRGGGHRPELLRELQRLHVTHTV
RKLHVGDFVWVAQETNPRDPANPGELVLDHIVERKRLDDLCSSIIDGRFREQKFRLKRCG
LERRVYLVEEHGSVHNLSLPESTLLQAVTNTQVIDGFFVKRTADIKESAAYLALL
TRGLQ
RLYQGHTLRSRPWGTPGNPESGAMTSPNPLCSLLTFSDFNAGAIKNKAQSVREVFARQLM
QVRGVSGEKAAALVDRYSTPASLLAAYDACATPKEQETLLSTIKCGRLQRNLGPALSRTL
SQLYCSYGPLT
Sequence length 551
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Homologous recombination
Fanconi anemia pathway
  Resolution of D-loop Structures through Holliday Junction Intermediates
Fanconi Anemia Pathway
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Cutis laxa CUTIS LAXA, AUTOSOMAL RECESSIVE, TYPE IB rs80356758, rs80356750, rs119489101, rs119489102, rs193302865, rs121918374, rs121918375, rs1598354372, rs1371235353, rs1598358449, rs121918376, rs121918377, rs121918378, rs137854453, rs1797225811
View all (31 more)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 29739952
Alternating hemiplegia of childhood Associate 19617716, 31633027
Bloom Syndrome Associate 21399624
Breast Neoplasms Associate 30947698
Carcinoma Hepatocellular Inhibit 18327812, 21175991
Cardiac Output Low Associate 36652992
Chromosome Aberrations Associate 21399624
Chromosome Breakage Associate 23479741
Colorectal Neoplasms Associate 21175991, 26867983
Leukemia Lymphocytic Chronic B Cell Stimulate 26970083