Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	80177
Gene name	MYC target 1
Gene symbol	MYCT1
Synonyms (NCBI Gene)	MTLC
Chromosome	6
Chromosome location	6q25.2

103

Show/Hide all (103)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017315	hsa-miR-335-5p	Microarray	18185580
MIRT1167895	hsa-miR-1208	CLIP-seq
MIRT1167896	hsa-miR-135a	CLIP-seq
MIRT1167897	hsa-miR-135b	CLIP-seq
MIRT1167898	hsa-miR-186	CLIP-seq
MIRT1167899	hsa-miR-2114	CLIP-seq
MIRT1167900	hsa-miR-3126-3p	CLIP-seq
MIRT1167901	hsa-miR-3128	CLIP-seq
MIRT1167902	hsa-miR-3133	CLIP-seq
MIRT1167903	hsa-miR-3153	CLIP-seq
MIRT1167904	hsa-miR-3163	CLIP-seq
MIRT1167905	hsa-miR-3174	CLIP-seq
MIRT1167906	hsa-miR-3190	CLIP-seq
MIRT1167907	hsa-miR-3192	CLIP-seq
MIRT1167908	hsa-miR-323-3p	CLIP-seq
MIRT1167909	hsa-miR-34b	CLIP-seq
MIRT1167910	hsa-miR-3622b-5p	CLIP-seq
MIRT1167911	hsa-miR-3671	CLIP-seq
MIRT1167912	hsa-miR-3681	CLIP-seq
MIRT1167913	hsa-miR-3935	CLIP-seq
MIRT1167914	hsa-miR-4260	CLIP-seq
MIRT1167915	hsa-miR-4320	CLIP-seq
MIRT1167916	hsa-miR-4426	CLIP-seq
MIRT1167917	hsa-miR-4428	CLIP-seq
MIRT1167918	hsa-miR-4476	CLIP-seq
MIRT1167919	hsa-miR-4533	CLIP-seq
MIRT1167920	hsa-miR-4647	CLIP-seq
MIRT1167921	hsa-miR-4662b	CLIP-seq
MIRT1167922	hsa-miR-4668-5p	CLIP-seq
MIRT1167923	hsa-miR-4691-3p	CLIP-seq
MIRT1167924	hsa-miR-4720-5p	CLIP-seq
MIRT1167925	hsa-miR-4762-5p	CLIP-seq
MIRT1167926	hsa-miR-4795-5p	CLIP-seq
MIRT1167927	hsa-miR-4799-3p	CLIP-seq
MIRT1167928	hsa-miR-485-5p	CLIP-seq
MIRT1167929	hsa-miR-486-3p	CLIP-seq
MIRT1167930	hsa-miR-548ad	CLIP-seq
MIRT1167931	hsa-miR-577	CLIP-seq
MIRT1167932	hsa-miR-607	CLIP-seq
MIRT1167933	hsa-miR-635	CLIP-seq
MIRT1167934	hsa-miR-661	CLIP-seq
MIRT1167935	hsa-miR-665	CLIP-seq
MIRT1167936	hsa-miR-890	CLIP-seq
MIRT1551474	hsa-miR-3646	CLIP-seq
MIRT1167895	hsa-miR-1208	CLIP-seq
MIRT2048431	hsa-miR-1305	CLIP-seq
MIRT1167896	hsa-miR-135a	CLIP-seq
MIRT1167897	hsa-miR-135b	CLIP-seq
MIRT1167900	hsa-miR-3126-3p	CLIP-seq
MIRT1167901	hsa-miR-3128	CLIP-seq
MIRT1167906	hsa-miR-3190	CLIP-seq
MIRT1167909	hsa-miR-34b	CLIP-seq
MIRT1167910	hsa-miR-3622b-5p	CLIP-seq
MIRT1167915	hsa-miR-4320	CLIP-seq
MIRT1167923	hsa-miR-4691-3p	CLIP-seq
MIRT2048432	hsa-miR-4716-5p	CLIP-seq
MIRT1167924	hsa-miR-4720-5p	CLIP-seq
MIRT2048433	hsa-miR-4772-3p	CLIP-seq
MIRT1167927	hsa-miR-4799-3p	CLIP-seq
MIRT2048434	hsa-miR-520d-5p	CLIP-seq
MIRT2048435	hsa-miR-524-5p	CLIP-seq
MIRT1167936	hsa-miR-890	CLIP-seq
MIRT2277290	hsa-miR-106a	CLIP-seq
MIRT2277291	hsa-miR-106b	CLIP-seq
MIRT2277292	hsa-miR-17	CLIP-seq
MIRT2277293	hsa-miR-20a	CLIP-seq
MIRT2277294	hsa-miR-20b	CLIP-seq
MIRT1167899	hsa-miR-2114	CLIP-seq
MIRT2277295	hsa-miR-3162-5p	CLIP-seq
MIRT1167914	hsa-miR-4260	CLIP-seq
MIRT2277296	hsa-miR-4328	CLIP-seq
MIRT1167929	hsa-miR-486-3p	CLIP-seq
MIRT2277297	hsa-miR-519d	CLIP-seq
MIRT2277298	hsa-miR-586	CLIP-seq
MIRT2277299	hsa-miR-624	CLIP-seq
MIRT1167936	hsa-miR-890	CLIP-seq
MIRT2277300	hsa-miR-93	CLIP-seq
MIRT2454662	hsa-miR-3136-5p	CLIP-seq
MIRT2454663	hsa-miR-4439	CLIP-seq
MIRT2454664	hsa-miR-582-3p	CLIP-seq
MIRT2454665	hsa-miR-943	CLIP-seq
MIRT2454662	hsa-miR-3136-5p	CLIP-seq
MIRT2454663	hsa-miR-4439	CLIP-seq
MIRT2454664	hsa-miR-582-3p	CLIP-seq
MIRT2454665	hsa-miR-943	CLIP-seq
MIRT2576137	hsa-miR-10a	CLIP-seq
MIRT2576138	hsa-miR-10b	CLIP-seq
MIRT2576139	hsa-miR-339-5p	CLIP-seq
MIRT2576140	hsa-miR-3667-5p	CLIP-seq
MIRT2576141	hsa-miR-371-5p	CLIP-seq
MIRT2576142	hsa-miR-371b-5p	CLIP-seq
MIRT2576143	hsa-miR-4421	CLIP-seq
MIRT2576144	hsa-miR-4725-5p	CLIP-seq
MIRT2576145	hsa-miR-504	CLIP-seq
MIRT2576137	hsa-miR-10a	CLIP-seq
MIRT2576138	hsa-miR-10b	CLIP-seq
MIRT2576139	hsa-miR-339-5p	CLIP-seq
MIRT2576140	hsa-miR-3667-5p	CLIP-seq
MIRT2576141	hsa-miR-371-5p	CLIP-seq
MIRT2576142	hsa-miR-371b-5p	CLIP-seq
MIRT2576143	hsa-miR-4421	CLIP-seq
MIRT2576144	hsa-miR-4725-5p	CLIP-seq
MIRT2576145	hsa-miR-504	CLIP-seq

Show/Hide all (5)

GO ID	Ontology	Definition	Evidence
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0016604	Component	Nuclear body	IDA
GO:0061484	Process	Hematopoietic stem cell homeostasis	IEA

MIM	HGNC	e!Ensembl
616805	23172	ENSG00000120279

Q8N699

Protein name

Myc target protein 1 (Myc target in myeloid cells protein 1)

Protein function

May regulate certain MYC target genes, MYC seems to be a direct upstream transcriptional activator. Does not seem to significantly affect growth cell capacity. Overexpression seems to mediate many of the known phenotypic features associated with

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15179	Myc_target_1	49 → 234	Myc target protein 1	Family

Tissue specificity

TISSUE SPECIFICITY: Down-regulated in gastric cancer tissues.

Sequence

MRTQVYEGLCKNYFSLAVLQRDRIKLLFFDILVFLSVFLLFLLFLVDIMANNTTSLGSPW
PENFWEDLIMSFTVSMAIGLVLGGFIWAVFICLSRRRRASAPISQWSSSRRSRSSYTHGL
NRTGFYRHSGCERRSNLSLASLTFQRQASLEQANSFPRKSSFRASTFHPFLQCPPLPVET
ESQLVTLPSSNISPTISTSHSLSRPDYWSSNSLRVGLSTPPPPAYESIIKAFPDS

Sequence length

235

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
UTERINE FIBROID	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (12)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Carcinogenesis	Associate	21998677, 28485541	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Associate	36868481	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Associate	22672838, 28485541, 31152622, 32659265	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	25331116	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Inhibit	28485541	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Associate	38172714	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Large B Cell Diffuse	Associate	38172714	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	21998677, 22672838, 38172714	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms Squamous Cell	Associate	22672838	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms Squamous Cell	Inhibit	22672838	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Associate	37334500	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	21998677, 22672838	★★★★★ ★☆☆☆☆ Found in Text Mining only

MYCT1 (MYC target 1)