Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	80168
Gene name Gene Name - the full gene name approved by the HGNC.	Monoacylglycerol O-acyltransferase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MOGAT2
Synonyms (NCBI Gene) Gene synonyms aliases	DGAT2L5, DGAT2L5., MGAT2, hDC5
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q13.5
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is an enzyme that catalyzes the synthesis of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA. The encoded protein is important in the uptake of dietary fat by the small intestine. This protein forms a complex wit

Show/Hide all(15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003846	Function	2-acylglycerol O-acyltransferase activity	IBA	21873635
GO:0003846	Function	2-acylglycerol O-acyltransferase activity	IDA	27184406
GO:0005783	Component	Endoplasmic reticulum	IDA	14966132
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006071	Process	Glycerol metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	IBA	21873635
GO:0006640	Process	Monoacylglycerol biosynthetic process	IDA	28420705
GO:0006651	Process	Diacylglycerol biosynthetic process	IBA	21873635
GO:0008374	Function	O-acyltransferase activity	IBA	21873635
GO:0016021	Component	Integral component of membrane	IEA
GO:0016407	Function	Acetyltransferase activity	IEA
GO:0019432	Process	Triglyceride biosynthetic process	IEA
GO:0019432	Process	Triglyceride biosynthetic process	TAS
GO:0050892	Process	Intestinal absorption	IEA
GO:1990578	Component	Perinuclear endoplasmic reticulum membrane	IDA	27184406

MIM	HGNC	e!Ensembl
610270	23248	ENSG00000166391

Protein

UniProt ID

Q3SYC2

Protein name

2-acylglycerol O-acyltransferase 2 (EC 2.3.1.20) (EC 2.3.1.22) (Acyl-CoA:monoacylglycerol acyltransferase 2) (MGAT2) (hMGAT2) (Diacylglycerol O-acyltransferase candidate 5) (hDC5) (Diacylglycerol acyltransferase 2-like protein 5) (Monoacylglycerol O-acylt

Protein function

Involved in glycerolipid synthesis and lipid metabolism (PubMed:12621063, PubMed:18768481, PubMed:27184406, PubMed:28420705). Catalyzes the formation of diacylglycerol, the precursor of triacylglycerol, by transferring the acyl chain of a fatty

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03982	DAGAT	39 → 334	Diacylglycerol acyltransferase	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in liver, small intestine, colon, stomach and kidney. {ECO:0000269|PubMed:12621063, ECO:0000269|PubMed:12824082}.

Sequence

MVEFAPLFMPWERRLQTLAVLQFVFSFLALAEICTVGFIALLFTRFWLLTVLYAAWWYLD
RDKPRQGGRHIQAIRCWTIWKYMKDYFPISLVKTAELDPSRNYIAGFHPHGVLAVGAFAN
LCTESTGFSSIFPGIRPHLMMLTLWFRAPFFRDYIMSAGLVTSEKESAAHILNRKGGGNL
LGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGAPLVPIFSFGENDLFDQIPNSSG
SWLRYIQNRLQKIMGISLPLFHGRGVFQYSFGLIPYRRPITTVVGKPIEVQKTLHPSEEE
VNQLHQRYIKELCNLFEAHKLKFNIPADQHLEFC

Sequence length

334

Interactions

View interactions

	KEGG		Reactome
	Glycerolipid metabolism Metabolic pathways Fat digestion and absorption		Triglyceride biosynthesis

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Gout	Gout	GWAS
Diabetes	Diabetes	GWAS

Show/Hide Text Mining Associations (5)

Disease Name	Relationship Type	References
Associations from Text Mining
Cholangiocarcinoma	Associate	34871464
Diabetes Mellitus	Associate	28729637
Inflammatory Breast Neoplasms	Associate	20830311
Non alcoholic Fatty Liver Disease	Associate	22394502
Weight Loss	Inhibit	22394502

MOGAT2 (monoacylglycerol O-acyltransferase 2)