MOGAT2 (monoacylglycerol O-acyltransferase 2)

Gene

• Entrez ID: 80168
• Gene name: Monoacylglycerol O-acyltransferase 2
• Gene symbol: MOGAT2
• Synonyms (NCBI Gene): DGAT2L5, DGAT2L5., MGAT2, hDC5
• Chromosome: 11
• Chromosome location: 11q13.5
• Summary: The protein encoded by this gene is an enzyme that catalyzes the synthesis of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA. The encoded protein is important in the uptake of dietary fat by the small intestine. This protein forms a complex wit

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003846	Function	2-acylglycerol O-acyltransferase activity	IBA
GO:0003846	Function	2-acylglycerol O-acyltransferase activity	IDA	27184406
GO:0003846	Function	2-acylglycerol O-acyltransferase activity	IEA
GO:0003846	Function	2-acylglycerol O-acyltransferase activity	TAS
GO:0004144	Function	Diacylglycerol O-acyltransferase activity	IBA
GO:0004144	Function	Diacylglycerol O-acyltransferase activity	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	14966132
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006071	Process	Glycerol metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006640	Process	Monoacylglycerol biosynthetic process	IDA	28420705
GO:0006651	Process	Diacylglycerol biosynthetic process	IBA
GO:0006651	Process	Diacylglycerol biosynthetic process	IEA
GO:0008374	Function	O-acyltransferase activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016407	Function	Acetyltransferase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0019432	Process	Triglyceride biosynthetic process	IBA
GO:0019432	Process	Triglyceride biosynthetic process	IEA
GO:0019432	Process	Triglyceride biosynthetic process	IEA
GO:0019432	Process	Triglyceride biosynthetic process	TAS
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050892	Process	Intestinal absorption	IEA
GO:1990578	Component	Perinuclear endoplasmic reticulum membrane	IDA	27184406

Other IDs

• MIM: 610270
• HGNC: 23248
• e!Ensembl: ENSG00000166391

Protein

• UniProt ID: Q3SYC2
• Protein name: 2-acylglycerol O-acyltransferase 2 (EC 2.3.1.20) (EC 2.3.1.22) (Acyl-CoA:monoacylglycerol acyltransferase 2) (MGAT2) (hMGAT2) (Diacylglycerol O-acyltransferase candidate 5) (hDC5) (Diacylglycerol acyltransferase 2-like protein 5) (Monoacylglycerol O-acylt
• Protein function: Involved in glycerolipid synthesis and lipid metabolism (PubMed:12621063, PubMed:18768481, PubMed:27184406, PubMed:28420705). Catalyzes the formation of diacylglycerol, the precursor of triacylglycerol, by transferring the acyl chain of a fatty
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03982	DAGAT	39 → 334	Diacylglycerol acyltransferase	Family

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in liver, small intestine, colon, stomach and kidney. {ECO:0000269|PubMed:12621063, ECO:0000269|PubMed:12824082}.
• Sequence:

  MVEFAPLFMPWERRLQTLAVLQFVFSFLALAEICTVGFIALLFTRFWLLTVLYAAWWYLD
  RDKPRQGGRHIQAIRCWTIWKYMKDYFPISLVKTAELDPSRNYIAGFHPHGVLAVGAFAN
  LCTESTGFSSIFPGIRPHLMMLTLWFRAPFFRDYIMSAGLVTSEKESAAHILNRKGGGNL
  LGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGAPLVPIFSFGENDLFDQIPNSSG
  SWLRYIQNRLQKIMGISLPLFHGRGVFQYSFGLIPYRRPITTVVGKPIEVQKTLHPSEEE
  VNQLHQRYIKELCNLFEAHKLKFNIPADQHLEFC

• Sequence length: 334

Pathways

KEGG:

Glycerolipid metabolism
Metabolic pathways
Fat digestion and absorption

Reactome:

Triglyceride biosynthesis