Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	80149
Gene name Gene Name - the full gene name approved by the HGNC.	Zinc finger CCCH-type containing 12A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ZC3H12A
Synonyms (NCBI Gene) Gene synonyms aliases	MCPIP, MCPIP-1, MCPIP1, Reg1, dJ423B22.1
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p34.3
Summary Summary of gene provided in NCBI Entrez Gene.	ZC3H12A is an MCP1 (CCL2; MIM 158105)-induced protein that acts as a transcriptional activator and causes cell death of cardiomyocytes, possibly via induction of genes associated with apoptosis.[supplied by OMIM, Mar 2008]

Show/Hide all(72)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018752	hsa-miR-335-5p	Microarray	18185580
MIRT443288	hsa-miR-4753-5p	PAR-CLIP	22100165
MIRT443287	hsa-miR-6858-3p	PAR-CLIP	22100165
MIRT443286	hsa-miR-4676-5p	PAR-CLIP	22100165
MIRT443285	hsa-miR-575	PAR-CLIP	22100165
MIRT443283	hsa-miR-3922-5p	PAR-CLIP	22100165
MIRT443284	hsa-miR-3194-5p	PAR-CLIP	22100165
MIRT736207	hsa-miR-193a-3p	Western blotting, Immunohistochemistry (IHC), RNA-seq, qRT-PCR	33544962
MIRT443288	hsa-miR-4753-5p	PAR-CLIP	22100165
MIRT443287	hsa-miR-6858-3p	PAR-CLIP	22100165
MIRT443286	hsa-miR-4676-5p	PAR-CLIP	22100165
MIRT443285	hsa-miR-575	PAR-CLIP	22100165
MIRT443283	hsa-miR-3922-5p	PAR-CLIP	22100165
MIRT443284	hsa-miR-3194-5p	PAR-CLIP	22100165
MIRT1505373	hsa-miR-1245b-3p	CLIP-seq
MIRT1505374	hsa-miR-1253	CLIP-seq
MIRT1505375	hsa-miR-219-5p	CLIP-seq
MIRT1505376	hsa-miR-3150b-3p	CLIP-seq
MIRT1505377	hsa-miR-3152-3p	CLIP-seq
MIRT1505378	hsa-miR-3185	CLIP-seq
MIRT1505379	hsa-miR-4434	CLIP-seq
MIRT1505380	hsa-miR-4445	CLIP-seq
MIRT1505381	hsa-miR-4459	CLIP-seq
MIRT1505382	hsa-miR-4516	CLIP-seq
MIRT1505383	hsa-miR-4534	CLIP-seq
MIRT1505384	hsa-miR-4700-3p	CLIP-seq
MIRT1505385	hsa-miR-4782-3p	CLIP-seq
MIRT1505386	hsa-miR-4784	CLIP-seq
MIRT1505387	hsa-miR-4786-3p	CLIP-seq
MIRT1505388	hsa-miR-4802-5p	CLIP-seq
MIRT1505389	hsa-miR-508-3p	CLIP-seq
MIRT1505390	hsa-miR-5095	CLIP-seq
MIRT1505391	hsa-miR-544	CLIP-seq
MIRT1505392	hsa-miR-765	CLIP-seq
MIRT2372563	hsa-miR-1202	CLIP-seq
MIRT2372564	hsa-miR-3972	CLIP-seq
MIRT2372565	hsa-miR-4514	CLIP-seq
MIRT2372566	hsa-miR-4691-3p	CLIP-seq
MIRT2372567	hsa-miR-4692	CLIP-seq
MIRT2665437	hsa-miR-101	CLIP-seq
MIRT1505373	hsa-miR-1245b-3p	CLIP-seq
MIRT2665438	hsa-miR-1324	CLIP-seq
MIRT2665439	hsa-miR-139-5p	CLIP-seq
MIRT2665440	hsa-miR-144	CLIP-seq
MIRT2665441	hsa-miR-1827	CLIP-seq
MIRT2665442	hsa-miR-214	CLIP-seq
MIRT2665443	hsa-miR-3125	CLIP-seq
MIRT2665444	hsa-miR-3166	CLIP-seq
MIRT2665445	hsa-miR-3616-3p	CLIP-seq
MIRT2665446	hsa-miR-3619-5p	CLIP-seq
MIRT2665447	hsa-miR-3916	CLIP-seq
MIRT2665448	hsa-miR-4265	CLIP-seq
MIRT2665449	hsa-miR-4269	CLIP-seq
MIRT2665450	hsa-miR-4296	CLIP-seq
MIRT2665451	hsa-miR-432	CLIP-seq
MIRT2665452	hsa-miR-4322	CLIP-seq
MIRT2665453	hsa-miR-4436b-3p	CLIP-seq
MIRT2665454	hsa-miR-4443	CLIP-seq
MIRT2665455	hsa-miR-4481	CLIP-seq
MIRT2665456	hsa-miR-4640-5p	CLIP-seq
MIRT2665457	hsa-miR-4649-3p	CLIP-seq
MIRT2665458	hsa-miR-4688	CLIP-seq
MIRT2665459	hsa-miR-4695-5p	CLIP-seq
MIRT2665460	hsa-miR-4726-5p	CLIP-seq
MIRT2665461	hsa-miR-4745-5p	CLIP-seq
MIRT1505387	hsa-miR-4786-3p	CLIP-seq
MIRT2665462	hsa-miR-486-3p	CLIP-seq
MIRT2665463	hsa-miR-629	CLIP-seq
MIRT2665464	hsa-miR-659	CLIP-seq
MIRT2665465	hsa-miR-761	CLIP-seq
MIRT2665466	hsa-miR-877	CLIP-seq
MIRT2665467	hsa-miR-9	CLIP-seq

Show/Hide all(139)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	18178554
GO:0000184	Process	Nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	ISS
GO:0000932	Component	P-body	IDA	22055188, 26134560
GO:0000932	Component	P-body	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001933	Process	Negative regulation of protein phosphorylation	ISS
GO:0002230	Process	Positive regulation of defense response to virus by host	IDA	23355615
GO:0002376	Process	Immune system process	IEA
GO:0002757	Process	Immune response-activating signaling pathway	IDA	19909337
GO:0003677	Function	DNA binding	IDA	18364357
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IDA	18364357
GO:0003723	Function	RNA binding	IDA	23355615
GO:0003723	Function	RNA binding	IEA
GO:0003729	Function	MRNA binding	IBA
GO:0003729	Function	MRNA binding	IDA	19909337
GO:0003730	Function	MRNA 3'-UTR binding	IEA
GO:0003730	Function	MRNA 3'-UTR binding	ISS
GO:0004518	Function	Nuclease activity	IEA
GO:0004519	Function	Endonuclease activity	IEA
GO:0004521	Function	RNA endonuclease activity	IBA
GO:0004521	Function	RNA endonuclease activity	IEA
GO:0004521	Function	RNA endonuclease activity	ISS
GO:0004532	Function	RNA exonuclease activity	IEA
GO:0004532	Function	RNA exonuclease activity	ISS
GO:0004540	Function	RNA nuclease activity	IDA	23355615
GO:0004843	Function	Cysteine-type deubiquitinase activity	IMP	25861989
GO:0005515	Function	Protein binding	IPI	16189514, 21900206, 21903422, 21988832, 24270572, 25416956, 25861989, 26134560, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	16574901
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	18178554, 19909337
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005791	Component	Rough endoplasmic reticulum	IEA
GO:0005856	Component	Cytoskeleton	IDA	19909337
GO:0006402	Process	MRNA catabolic process	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0006974	Process	DNA damage response	IMP	25861989
GO:0007399	Process	Nervous system development	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010468	Process	Regulation of gene expression	IDA	24048733
GO:0010508	Process	Positive regulation of autophagy	IDA	22739135
GO:0010508	Process	Positive regulation of autophagy	IEA
GO:0010587	Process	MiRNA catabolic process	IDA	22055188
GO:0010595	Process	Positive regulation of endothelial cell migration	IDA	18364357
GO:0010628	Process	Positive regulation of gene expression	IDA	22739135
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010656	Process	Negative regulation of muscle cell apoptotic process	IEA
GO:0010656	Process	Negative regulation of muscle cell apoptotic process	ISS
GO:0010884	Process	Positive regulation of lipid storage	IDA	22739135
GO:0010884	Process	Positive regulation of lipid storage	IEA
GO:0016020	Component	Membrane	IEA
GO:0016579	Process	Protein deubiquitination	IDA	24048733
GO:0016787	Function	Hydrolase activity	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030867	Component	Rough endoplasmic reticulum membrane	IEA
GO:0030867	Component	Rough endoplasmic reticulum membrane	ISS
GO:0032689	Process	Negative regulation of type II interferon production	IEA
GO:0032689	Process	Negative regulation of type II interferon production	ISS
GO:0032691	Process	Negative regulation of interleukin-1 beta production	IEA
GO:0032691	Process	Negative regulation of interleukin-1 beta production	ISS
GO:0032715	Process	Negative regulation of interleukin-6 production	IDA	18178554
GO:0032715	Process	Negative regulation of interleukin-6 production	IEA
GO:0032715	Process	Negative regulation of interleukin-6 production	ISS
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IDA	18178554
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IEA
GO:0032720	Process	Negative regulation of tumor necrosis factor production	ISS
GO:0032991	Component	Protein-containing complex	IDA	25861989
GO:0034599	Process	Cellular response to oxidative stress	IEA
GO:0034599	Process	Cellular response to oxidative stress	ISS
GO:0035198	Function	MiRNA binding	IDA	22055188
GO:0035613	Function	RNA stem-loop binding	IEA
GO:0035613	Function	RNA stem-loop binding	ISS
GO:0035925	Function	MRNA 3'-UTR AU-rich region binding	IEA
GO:0035925	Function	MRNA 3'-UTR AU-rich region binding	ISS
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IBA
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA
GO:0042149	Process	Cellular response to glucose starvation	IEA
GO:0042149	Process	Cellular response to glucose starvation	ISS
GO:0042307	Process	Positive regulation of protein import into nucleus	IDA	24048733
GO:0043022	Function	Ribosome binding	IEA
GO:0043022	Function	Ribosome binding	ISS
GO:0043031	Process	Negative regulation of macrophage activation	IDA	18178554
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IDA	18178554
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IEA
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IMP	25861989
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	ISS
GO:0044828	Process	Host-mediated suppression of viral genome replication	IDA	23355615
GO:0045019	Process	Negative regulation of nitric oxide biosynthetic process	IDA	18178554
GO:0045019	Process	Negative regulation of nitric oxide biosynthetic process	IEA
GO:0045600	Process	Positive regulation of fat cell differentiation	IDA	22739135
GO:0045600	Process	Positive regulation of fat cell differentiation	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IDA	18364357
GO:0045766	Process	Positive regulation of angiogenesis	IMP	24048733
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	18364357
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050852	Process	T cell receptor signaling pathway	IEA
GO:0050852	Process	T cell receptor signaling pathway	ISS
GO:0051259	Process	Protein complex oligomerization	IDA	22055188, 23355615
GO:0051607	Process	Defense response to virus	IEA
GO:0055118	Process	Negative regulation of cardiac muscle contraction	IEA
GO:0055118	Process	Negative regulation of cardiac muscle contraction	ISS
GO:0061014	Process	Positive regulation of mRNA catabolic process	IDA	19909337
GO:0061014	Process	Positive regulation of mRNA catabolic process	IEA
GO:0061014	Process	Positive regulation of mRNA catabolic process	ISS
GO:0061158	Process	3'-UTR-mediated mRNA destabilization	IBA
GO:0061158	Process	3'-UTR-mediated mRNA destabilization	IDA	19909337
GO:0061158	Process	3'-UTR-mediated mRNA destabilization	IEA
GO:0061158	Process	3'-UTR-mediated mRNA destabilization	ISS
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	18178554, 19909337, 22055188
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IMP	25861989
GO:0071347	Process	Cellular response to interleukin-1	ISS
GO:0071356	Process	Cellular response to tumor necrosis factor	IDA	19909337
GO:0098586	Process	Cellular response to virus	IDA	23355615
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	IEA
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	ISS
GO:1900119	Process	Positive regulation of execution phase of apoptosis	IEA
GO:1900119	Process	Positive regulation of execution phase of apoptosis	ISS
GO:1900745	Process	Positive regulation of p38MAPK cascade	IDA	24048733
GO:1901223	Process	Negative regulation of non-canonical NF-kappaB signal transduction	IEA
GO:1901223	Process	Negative regulation of non-canonical NF-kappaB signal transduction	ISS
GO:1903003	Process	Positive regulation of protein deubiquitination	IMP	25861989
GO:1903936	Process	Cellular response to sodium arsenite	IEA
GO:1903936	Process	Cellular response to sodium arsenite	ISS
GO:1904637	Process	Cellular response to ionomycin	IEA
GO:1904637	Process	Cellular response to ionomycin	ISS
GO:1990869	Process	Cellular response to chemokine	IDA	18364357
GO:1990869	Process	Cellular response to chemokine	IEA
GO:2000320	Process	Negative regulation of T-helper 17 cell differentiation	IEA
GO:2000320	Process	Negative regulation of T-helper 17 cell differentiation	ISS
GO:2000379	Process	Positive regulation of reactive oxygen species metabolic process	IDA	22739135
GO:2000627	Process	Positive regulation of miRNA catabolic process	IDA	24048733

MIM	HGNC	e!Ensembl
610562	26259	ENSG00000163874

Protein

UniProt ID

Q5D1E8

Protein name

Endoribonuclease ZC3H12A (EC 3.1.-.-) (Monocyte chemotactic protein-induced protein 1) (MCP-induced protein 1) (MCPIP-1) (Regnase-1) (Reg1) (Zinc finger CCCH domain-containing protein 12A)

Protein function

Endoribonuclease involved in various biological functions such as cellular inflammatory response and immune homeostasis, glial differentiation of neuroprogenitor cells, cell death of cardiomyocytes, adipogenesis and angiogenesis. Functions as an

PDB

3V32 , 3V33 , 3V34

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF18039	UBA_6	48 → 89	UBA-like domain	Domain
PF11977	RNase_Zc3h12a	134 → 290	Zc3h12a-like Ribonuclease NYN domain	Domain
PF18561	Regnase_1_C	549 → 593	Endoribonuclease Regnase 1/ ZC3H12 C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in heart, placenta, spleen, kidney, liver and lung (PubMed:19909337). Expressed in leukocytes (PubMed:19909337). Expressed in monocyte (PubMed:16574901). {ECO:0000269|PubMed:16574901, ECO:0000269|PubMed:19909337}.

Sequence

MSGPCGEKPVLEASPTMSLWEFEDSHSRQGTPRPGQELAAEEASALELQMKVDFFRKLGY
SSTEIHSVLQKLGVQADTNTVLGELVKHGTATERERQTSPDPCPQLPLVPRGGGTPKAPN
LEPPLPEEEKEGSDLRPVVIDGSNVAMSHGNKEVFSCRGILLAVNWFLERGHTDITVFVP
SWRKEQPRPDVPITDQHILRELEKKKILVFTPSRRVGGKRVVCYDDRFIVKLAYESDGIV
VSNDTYRDLQGERQEWKRFIEERLLMYSFVNDKFMPPDDPLGRHGPSLDNFLRKKPLTLE
HRKQPCPYGRKCTYGIKCRFFHPERPSCPQRSVADELRANALLSPPRAPSKDKNGRRPSP
SSQSSSLLTESEQCSLDGKKLGAQASPGSRQEGLTQTYAPSGRSLAPSGGSGSSFGPTDW
LPQTLDSLPYVSQDCLDSGIGSLESQMSELWGVRGGGPGEPGPPRAPYTGYSPYGSELPA
TAAFSAFGRAMGAGHFSVPADYPPAPPAFPPREYWSEPYPLPPPTSVLQEPPVQSPGAGR
SPWGRAGSLAKEQASVYTKLCGVFPPHLVEAVMGRFPQLLDPQQLAAEILSYKSQHPSE

Sequence length

599

Interactions

View interactions

ZC3H12A (zinc finger CCCH-type containing 12A)