Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	80145
Gene name	THO complex subunit 7
Gene symbol	THOC7
Synonyms (NCBI Gene)	NIF3L1BP1fSAP24hTREX30
Chromosome	3
Chromosome location	3p14.1

Show/Hide all (55)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020736	hsa-miR-155-5p	Proteomics	18668040
MIRT029391	hsa-miR-26b-5p	Microarray	19088304
MIRT1423507	hsa-miR-1323	CLIP-seq
MIRT1423508	hsa-miR-1343	CLIP-seq
MIRT1423509	hsa-miR-140-3p	CLIP-seq
MIRT1423510	hsa-miR-2115	CLIP-seq
MIRT1423511	hsa-miR-3121-5p	CLIP-seq
MIRT1423512	hsa-miR-3125	CLIP-seq
MIRT1423513	hsa-miR-3192	CLIP-seq
MIRT1423514	hsa-miR-335	CLIP-seq
MIRT1423515	hsa-miR-3653	CLIP-seq
MIRT1423516	hsa-miR-3658	CLIP-seq
MIRT1423517	hsa-miR-3685	CLIP-seq
MIRT1423518	hsa-miR-3916	CLIP-seq
MIRT1423519	hsa-miR-3977	CLIP-seq
MIRT1423520	hsa-miR-4517	CLIP-seq
MIRT1423521	hsa-miR-4724-5p	CLIP-seq
MIRT1423522	hsa-miR-4764-5p	CLIP-seq
MIRT1423523	hsa-miR-513c	CLIP-seq
MIRT1423524	hsa-miR-514b-5p	CLIP-seq
MIRT1423525	hsa-miR-516a-3p	CLIP-seq
MIRT1423526	hsa-miR-541	CLIP-seq
MIRT1423527	hsa-miR-548o	CLIP-seq
MIRT1423528	hsa-miR-584	CLIP-seq
MIRT1423529	hsa-miR-586	CLIP-seq
MIRT1423530	hsa-miR-654-5p	CLIP-seq
MIRT1423531	hsa-miR-758	CLIP-seq
MIRT1423507	hsa-miR-1323	CLIP-seq
MIRT1423508	hsa-miR-1343	CLIP-seq
MIRT1423510	hsa-miR-2115	CLIP-seq
MIRT1423513	hsa-miR-3192	CLIP-seq
MIRT1423515	hsa-miR-3653	CLIP-seq
MIRT1423516	hsa-miR-3658	CLIP-seq
MIRT1423517	hsa-miR-3685	CLIP-seq
MIRT1423519	hsa-miR-3977	CLIP-seq
MIRT1423522	hsa-miR-4764-5p	CLIP-seq
MIRT2126873	hsa-miR-4797-5p	CLIP-seq
MIRT2126874	hsa-miR-496	CLIP-seq
MIRT1423525	hsa-miR-516a-3p	CLIP-seq
MIRT1423526	hsa-miR-541	CLIP-seq
MIRT1423527	hsa-miR-548o	CLIP-seq
MIRT1423528	hsa-miR-584	CLIP-seq
MIRT1423530	hsa-miR-654-5p	CLIP-seq
MIRT1423528	hsa-miR-584	CLIP-seq
MIRT1423507	hsa-miR-1323	CLIP-seq
MIRT1423509	hsa-miR-140-3p	CLIP-seq
MIRT1423514	hsa-miR-335	CLIP-seq
MIRT1423523	hsa-miR-513c	CLIP-seq
MIRT1423524	hsa-miR-514b-5p	CLIP-seq
MIRT1423527	hsa-miR-548o	CLIP-seq
MIRT1423507	hsa-miR-1323	CLIP-seq
MIRT1423514	hsa-miR-335	CLIP-seq
MIRT1423523	hsa-miR-513c	CLIP-seq
MIRT1423524	hsa-miR-514b-5p	CLIP-seq
MIRT1423527	hsa-miR-548o	CLIP-seq

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000346	Component	Transcription export complex	IDA	15833825, 15998806
GO:0000347	Component	THO complex	IDA	15998806
GO:0000445	Component	THO complex part of transcription export complex	IBA
GO:0000445	Component	THO complex part of transcription export complex	IDA	15998806
GO:0000445	Component	THO complex part of transcription export complex	IEA
GO:0000781	Component	Chromosome, telomeric region	IDA	24270157
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	12951069, 19059247, 26496610, 32296183
GO:0005634	Component	Nucleus	IDA	12951069, 19059247
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	12951069
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006397	Process	MRNA processing	IEA
GO:0006406	Process	MRNA export from nucleus	IBA
GO:0006406	Process	MRNA export from nucleus	IDA	17190602
GO:0008380	Process	RNA splicing	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0016607	Component	Nuclear speck	IEA
GO:0051028	Process	MRNA transport	IEA

MIM	HGNC	e!Ensembl
611965	29874	ENSG00000163634

Q6I9Y2

Protein name

THO complex subunit 7 (Functional spliceosome-associated protein 24) (fSAP24) (Ngg1-interacting factor 3-like protein 1-binding protein 1) (NIF3L1-binding protein 1) (hTREX30)

Protein function

Component of the THO subcomplex of the TREX complex which is thought to couple mRNA transcription, processing and nuclear export, and which specifically associates with spliced mRNA and not with unspliced pre-mRNA (PubMed:15833825, PubMed:159988

PDB

7APK , 7ZNK , 7ZNL

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05615	THOC7	7 → 139	Tho complex subunit 7	Family

Sequence

MGAVTDDEVIRKRLLIDGDGAGDDRRINLLVKSFIKWCNSGSQEEGYSQYQRMLSTLSQC
EFSMGKTLLVYDMNLREMENYEKIYKEIECSIAGAHEKIAECKKQILQAKRIRKNRQEYD
ALAKVIQHHPDRHETLKELEALGKELEHLSHIKESVEDKLELRRKQFHVLLSTIHELQQT
LENDEKLSEVEEAQEASMETDPKP

Sequence length

204

Interactions

View interactions

	KEGG		Reactome
	Nucleocytoplasmic transport		Transport of Mature mRNA derived from an Intron-Containing Transcript mRNA 3'-end processing RNA Polymerase II Transcription Termination

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANOREXIA NERVOSA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (1)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Pulmonary Disease Chronic Obstructive	Associate	28416970	★★★★★ ★☆☆☆☆ Found in Text Mining only

THOC7 (THO complex subunit 7)