Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
80142
Gene name Gene Name - the full gene name approved by the HGNC.
Prostaglandin E synthase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PTGES2
Synonyms (NCBI Gene) Gene synonyms aliases
C9orf15, GBF-1, GBF1, PGES2, mPGES-2
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9q34.11
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a membrane-associated prostaglandin E synthase, which catalyzes the conversion of prostaglandin H2 to prostaglandin E2. This protein also has been shown to activate the transcription regulated by a gamma-interferon-acti
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016466 hsa-miR-193b-3p Proteomics 21512034
MIRT028318 hsa-miR-32-5p Sequencing 20371350
MIRT052529 hsa-let-7a-5p CLASH 23622248
MIRT052205 hsa-let-7b-5p CLASH 23622248
MIRT051829 hsa-let-7c-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IDA 12835322
GO:0000139 Component Golgi membrane IEA
GO:0001516 Process Prostaglandin biosynthetic process IEA
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 25416956, 32353859, 33060197, 36217030
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608152 17822 ENSG00000148334
Protein
UniProt ID Q9H7Z7
Protein name Prostaglandin E synthase 2 (EC 5.3.99.3) (Membrane-associated prostaglandin E synthase-2) (mPGE synthase-2) (Microsomal prostaglandin E synthase 2) (mPGES-2) (Prostaglandin-H(2) E-isomerase) [Cleaved into: Prostaglandin E synthase 2 truncated form]
Protein function Isomerase that catalyzes the conversion of PGH2 into the more stable prostaglandin E2 (PGE2) (in vitro) (PubMed:12804604, PubMed:17585783, PubMed:18198127). The biological function and the GSH-dependent property of PTGES2 is still under debate (
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13417 GST_N_3 104 174 Glutathione S-transferase, N-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expressed in the heart, including apex, inter-ventricular septum, both atria and ventricles, but not in the aorta. Also expressed in fetal heart. Detected in various regions of the brain: cerebellum; occipital, fronta
Sequence
MDPAARVVRALWPGGCALAWRLGGRPQPLLPTQSRAGFAGAAGGPSPVAAARKGSPRLLG
AAALALGGALGLYHTARWHLRAQDLHAERSAAQLSLSSRLQLTLYQYKTCPFCSKVRAFL
DFHALPYQVVEVNPVRRAEIKFSSYRKVPILVAQEGESSQQLNDSSVIISALKT
YLVSGQ
PLEEIITYYPAMKAVNEQGKEVTEFGNKYWLMLNEKEAQQVYGGKEARTEEMKWRQWADD
WLVHLISPNVYRTPTEALASFDYIVREGKFGAVEGAVAKYMGAAAMYLISKRLKSRHRLQ
DNVREDLYEAADKWVAAVGKDRPFMGGQKPNLADLAVYGVLRVMEGLDAFDDLMQHTHIQ
PWYLRVERAITEASPAH
Sequence length 377
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Arachidonic acid metabolism
Metabolic pathways
  Synthesis of Prostaglandins (PG) and Thromboxanes (TX)
Neutrophil degranulation
<