Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	80142
Gene name	Prostaglandin E synthase 2
Gene symbol	PTGES2
Synonyms (NCBI Gene)	C9orf15GBF-1GBF1PGES2mPGES-2
Chromosome	9
Chromosome location	9q34.11
Summary	The protein encoded by this gene is a membrane-associated prostaglandin E synthase, which catalyzes the conversion of prostaglandin H2 to prostaglandin E2. This protein also has been shown to activate the transcription regulated by a gamma-interferon-acti

112

Show/Hide all (112)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016466	hsa-miR-193b-3p	Proteomics	21512034
MIRT028318	hsa-miR-32-5p	Sequencing	20371350
MIRT052529	hsa-let-7a-5p	CLASH	23622248
MIRT052205	hsa-let-7b-5p	CLASH	23622248
MIRT051829	hsa-let-7c-5p	CLASH	23622248
MIRT437844	hsa-miR-146a-5p	Luciferase reporter assay	23589616
MIRT470084	hsa-miR-137	PAR-CLIP	23592263
MIRT470083	hsa-miR-6753-5p	PAR-CLIP	23592263
MIRT470082	hsa-miR-6834-3p	PAR-CLIP	23592263
MIRT470081	hsa-miR-25-3p	PAR-CLIP	23592263
MIRT028318	hsa-miR-32-5p	PAR-CLIP	23592263
MIRT470080	hsa-miR-363-3p	PAR-CLIP	23592263
MIRT470079	hsa-miR-367-3p	PAR-CLIP	23592263
MIRT470078	hsa-miR-92a-3p	PAR-CLIP	23592263
MIRT470077	hsa-miR-92b-3p	PAR-CLIP	23592263
MIRT107246	hsa-miR-1247-3p	PAR-CLIP	23592263
MIRT470076	hsa-miR-4532	PAR-CLIP	23592263
MIRT470075	hsa-miR-3124-3p	PAR-CLIP	23592263
MIRT470074	hsa-miR-3188	PAR-CLIP	23592263
MIRT470073	hsa-miR-4481	PAR-CLIP	23592263
MIRT470072	hsa-miR-4745-5p	PAR-CLIP	23592263
MIRT470071	hsa-miR-1292-5p	PAR-CLIP	23592263
MIRT470070	hsa-miR-4471	PAR-CLIP	23592263
MIRT470069	hsa-miR-8059	PAR-CLIP	23592263
MIRT470068	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT470067	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT470066	hsa-miR-4433a-5p	PAR-CLIP	23592263
MIRT470065	hsa-miR-4449	PAR-CLIP	23592263
MIRT470064	hsa-miR-548aw	PAR-CLIP	23592263
MIRT470063	hsa-miR-518a-5p	PAR-CLIP	23592263
MIRT470062	hsa-miR-527	PAR-CLIP	23592263
MIRT470061	hsa-miR-4433b-5p	PAR-CLIP	23592263
MIRT470060	hsa-miR-450a-1-3p	PAR-CLIP	23592263
MIRT470084	hsa-miR-137	PAR-CLIP	23592263
MIRT470083	hsa-miR-6753-5p	PAR-CLIP	23592263
MIRT470082	hsa-miR-6834-3p	PAR-CLIP	23592263
MIRT470081	hsa-miR-25-3p	PAR-CLIP	23592263
MIRT028318	hsa-miR-32-5p	PAR-CLIP	23592263
MIRT470080	hsa-miR-363-3p	PAR-CLIP	23592263
MIRT470079	hsa-miR-367-3p	PAR-CLIP	23592263
MIRT470078	hsa-miR-92a-3p	PAR-CLIP	23592263
MIRT470077	hsa-miR-92b-3p	PAR-CLIP	23592263
MIRT107246	hsa-miR-1247-3p	PAR-CLIP	23592263
MIRT470076	hsa-miR-4532	PAR-CLIP	23592263
MIRT470075	hsa-miR-3124-3p	PAR-CLIP	23592263
MIRT470074	hsa-miR-3188	PAR-CLIP	23592263
MIRT470073	hsa-miR-4481	PAR-CLIP	23592263
MIRT470072	hsa-miR-4745-5p	PAR-CLIP	23592263
MIRT470071	hsa-miR-1292-5p	PAR-CLIP	23592263
MIRT470070	hsa-miR-4471	PAR-CLIP	23592263
MIRT470069	hsa-miR-8059	PAR-CLIP	23592263
MIRT470068	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT470067	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT470066	hsa-miR-4433a-5p	PAR-CLIP	23592263
MIRT470065	hsa-miR-4449	PAR-CLIP	23592263
MIRT470064	hsa-miR-548aw	PAR-CLIP	23592263
MIRT470063	hsa-miR-518a-5p	PAR-CLIP	23592263
MIRT470062	hsa-miR-527	PAR-CLIP	23592263
MIRT470061	hsa-miR-4433b-5p	PAR-CLIP	23592263
MIRT470060	hsa-miR-450a-1-3p	PAR-CLIP	23592263
MIRT1272675	hsa-miR-1292	CLIP-seq
MIRT1272676	hsa-miR-1537	CLIP-seq
MIRT1272677	hsa-miR-25	CLIP-seq
MIRT1272678	hsa-miR-32	CLIP-seq
MIRT1272679	hsa-miR-363	CLIP-seq
MIRT1272680	hsa-miR-367	CLIP-seq
MIRT1272681	hsa-miR-370	CLIP-seq
MIRT1272682	hsa-miR-4421	CLIP-seq
MIRT1272683	hsa-miR-495	CLIP-seq
MIRT1272684	hsa-miR-626	CLIP-seq
MIRT1272685	hsa-miR-92a	CLIP-seq
MIRT1272686	hsa-miR-92b	CLIP-seq
MIRT2080184	hsa-miR-3677-5p	CLIP-seq
MIRT2080185	hsa-miR-663b	CLIP-seq
MIRT2306460	hsa-miR-1265	CLIP-seq
MIRT1272675	hsa-miR-1292	CLIP-seq
MIRT2306461	hsa-miR-1302	CLIP-seq
MIRT2306462	hsa-miR-1915	CLIP-seq
MIRT1272677	hsa-miR-25	CLIP-seq
MIRT2306463	hsa-miR-3180	CLIP-seq
MIRT2306464	hsa-miR-3180-3p	CLIP-seq
MIRT2306465	hsa-miR-3184	CLIP-seq
MIRT2306466	hsa-miR-3196	CLIP-seq
MIRT1272678	hsa-miR-32	CLIP-seq
MIRT2306467	hsa-miR-34a	CLIP-seq
MIRT2306468	hsa-miR-34c-5p	CLIP-seq
MIRT1272679	hsa-miR-363	CLIP-seq
MIRT2306469	hsa-miR-3652	CLIP-seq
MIRT1272680	hsa-miR-367	CLIP-seq
MIRT2306470	hsa-miR-423-5p	CLIP-seq
MIRT2306471	hsa-miR-4252	CLIP-seq
MIRT2306472	hsa-miR-4298	CLIP-seq
MIRT2306473	hsa-miR-4430	CLIP-seq
MIRT2306474	hsa-miR-4436b-3p	CLIP-seq
MIRT2306475	hsa-miR-4446-3p	CLIP-seq
MIRT2306476	hsa-miR-4492	CLIP-seq
MIRT2306477	hsa-miR-4498	CLIP-seq
MIRT2306478	hsa-miR-449a	CLIP-seq
MIRT2306479	hsa-miR-449b	CLIP-seq
MIRT2306480	hsa-miR-4691-3p	CLIP-seq
MIRT2306481	hsa-miR-4736	CLIP-seq
MIRT2306482	hsa-miR-665	CLIP-seq
MIRT2306483	hsa-miR-762	CLIP-seq
MIRT1272685	hsa-miR-92a	CLIP-seq
MIRT1272686	hsa-miR-92b	CLIP-seq
MIRT2393181	hsa-miR-2278	CLIP-seq
MIRT1272677	hsa-miR-25	CLIP-seq
MIRT1272678	hsa-miR-32	CLIP-seq
MIRT1272679	hsa-miR-363	CLIP-seq
MIRT1272680	hsa-miR-367	CLIP-seq
MIRT1272685	hsa-miR-92a	CLIP-seq
MIRT1272686	hsa-miR-92b	CLIP-seq

Show/Hide all (39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IDA	12835322
GO:0000139	Component	Golgi membrane	IEA
GO:0001516	Process	Prostaglandin biosynthetic process	IEA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 32353859, 33060197, 36217030
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HDA	20833797
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IDA	12835322
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006629	Process	Lipid metabolic process	IDA	17585783
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006633	Process	Fatty acid biosynthetic process	IEA
GO:0006693	Process	Prostaglandin metabolic process	IEA
GO:0016020	Component	Membrane	IEA
GO:0016829	Function	Lyase activity	IDA	17585783
GO:0016829	Function	Lyase activity	IEA
GO:0016829	Function	Lyase activity	ISS
GO:0016853	Function	Isomerase activity	IEA
GO:0020037	Function	Heme binding	ISS
GO:0035578	Component	Azurophil granule lumen	TAS
GO:0036134	Function	12-hydroxyheptadecatrienoic acid synthase activity	IEA
GO:0043295	Function	Glutathione binding	ISS
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0046457	Process	Prostanoid biosynthetic process	IEA
GO:0046457	Process	Prostanoid biosynthetic process	TAS
GO:0046903	Process	Secretion	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050220	Function	Prostaglandin-E synthase activity	EXP	10922363
GO:0050220	Function	Prostaglandin-E synthase activity	IBA
GO:0050220	Function	Prostaglandin-E synthase activity	IDA	12804604
GO:0050220	Function	Prostaglandin-E synthase activity	IEA

MIM	HGNC	e!Ensembl
608152	17822	ENSG00000148334

Q9H7Z7

Protein name

Prostaglandin E synthase 2 (EC 5.3.99.3) (Membrane-associated prostaglandin E synthase-2) (mPGE synthase-2) (Microsomal prostaglandin E synthase 2) (mPGES-2) (Prostaglandin-H(2) E-isomerase) [Cleaved into: Prostaglandin E synthase 2 truncated form]

Protein function

Isomerase that catalyzes the conversion of PGH2 into the more stable prostaglandin E2 (PGE2) (in vitro) (PubMed:12804604, PubMed:17585783, PubMed:18198127). The biological function and the GSH-dependent property of PTGES2 is still under debate (

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13417	GST_N_3	104 → 174	Glutathione S-transferase, N-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Expressed in the heart, including apex, inter-ventricular septum, both atria and ventricles, but not in the aorta. Also expressed in fetal heart. Detected in various regions of the brain: cerebellum; occipital, fronta

Sequence

MDPAARVVRALWPGGCALAWRLGGRPQPLLPTQSRAGFAGAAGGPSPVAAARKGSPRLLG
AAALALGGALGLYHTARWHLRAQDLHAERSAAQLSLSSRLQLTLYQYKTCPFCSKVRAFL
DFHALPYQVVEVNPVRRAEIKFSSYRKVPILVAQEGESSQQLNDSSVIISALKTYLVSGQ
PLEEIITYYPAMKAVNEQGKEVTEFGNKYWLMLNEKEAQQVYGGKEARTEEMKWRQWADD
WLVHLISPNVYRTPTEALASFDYIVREGKFGAVEGAVAKYMGAAAMYLISKRLKSRHRLQ
DNVREDLYEAADKWVAAVGKDRPFMGGQKPNLADLAVYGVLRVMEGLDAFDDLMQHTHIQ
PWYLRVERAITEASPAH

Sequence length

377

Interactions

View interactions

	KEGG		Reactome
	Arachidonic acid metabolism Metabolic pathways		Synthesis of Prostaglandins (PG) and Thromboxanes (TX) Neutrophil degranulation

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Familial cancer of breast	Uncertain significance	rs770175597	RCV005932337

Show/Hide Text Mining Associations (18)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Alzheimer Disease	Associate	19664621
Carcinoma Pancreatic Ductal	Associate	40269781
Carpal Tunnel Syndrome	Inhibit	34224495
Colorectal Neoplasms	Associate	16495511
Cysts	Associate	30794864
Endometrial Neoplasms	Associate	21589857, 27230680
Endometriosis	Associate	24035605
Gastritis	Associate	15531909
MASS syndrome	Associate	31947646
Osteoarthritis	Associate	15225371
Pancreatic Neoplasms	Associate	30794864
Primary Graft Dysfunction	Associate	24467603
Prostatic Neoplasms	Stimulate	21308720
Status Asthmaticus	Inhibit	24875618
Stomach Ulcer	Associate	15531909
Ulcer	Associate	15531909
Uterine Diseases	Associate	24035605
Ventricular Dysfunction Left	Associate	31947646

PTGES2 (prostaglandin E synthase 2)