Gene Gene information from NCBI Gene database.
Entrez ID 80139
Gene name Zinc finger protein 703
Gene symbol ZNF703
Synonyms (NCBI Gene)
NLZ1ZEPPO1ZNF503LZPO1
Chromosome 8
Chromosome location 8p11.23
miRNA miRNA information provided by mirtarbase database.
1119
miRTarBase ID miRNA Experiments Reference
MIRT050650 hsa-miR-18a-5p CLASH 23622248
MIRT050098 hsa-miR-26a-5p CLASH 23622248
MIRT049534 hsa-miR-92a-3p CLASH 23622248
MIRT049534 hsa-miR-92a-3p CLASH 23622248
MIRT042430 hsa-miR-425-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
35
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 21328542, 28514442, 33961781
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 21328542, 21337521
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IDA 21328542
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
617045 25883 ENSG00000183779
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9H7S9
Protein name Zinc finger protein 703 (Zinc finger elbow-related proline domain protein 1)
Protein function Transcriptional corepressor which does not bind directly to DNA and may regulate transcription through recruitment of histone deacetylases to gene promoters. Regulates cell adhesion, migration and proliferation. May be required for segmental gen
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12402 nlz1 311 365 NocA-like zinc-finger protein 1 Family
Tissue specificity TISSUE SPECIFICITY: Expressed in mammary epithelium. {ECO:0000269|PubMed:21317240}.
Sequence
MSDSPAGSNPRTPESSGSGSGGGGKRPAVPAAVSLLPPADPLRQANRLPIRVLKMLSAHT
GHLLHPEYLQPLSSTPVSPIELDAKKSPLALLAQTCSQIGKPDPPPSSKLNSVAAAANGL
GAEKDPGRSAPGAASAAAALKQLGDSPAEDKSSFKPYSKGSGGGDSRKDSGSSSVSSTSS
SSSSSPGDKAGFRVPSAACPPFPPHGAPVSASSSSSSPGGSRGGSPHHSDCKNGGGVGGG
ELDKKDQEPKPSPEPAAVSRGGGGEPGAHGGAESGASGRKSEPPSALVGAGHVAPVSPYK
PGHSVFPLPPSSIGYHGSIVGAYAGYPSQFVPGLDPSKSGLVGGQLSGGLGLPPGKPPSS
SPLTG
ASPPSFLQGLCRDPYCLGGYHGASHLGGSSCSTCSAHDPAGPSLKAGGYPLVYPG
HPLQPAALSSSAAQAALPGHPLYTYGFMLQNEPLPHSCNWVAASGPCDKRFATSEELLSH
LRTHTALPGAEKLLAAYPGASGLGSAAAAAAAAASCHLHLPPPAAPGSPGSLSLRNPHTL
GLSRYHPYGKSHLSTAGGLAVPSLPTAGPYYSPYALYGQRLASASALGYQ
Sequence length 590
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Generic Transcription Pathway
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
OLIGODENDROGLIOMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Breast Neoplasms Associate 21328542, 22747683, 23991038, 24156016, 25742952, 30252041, 35236318, 35590107
★☆☆☆☆
Found in Text Mining only
Carcinoma Neuroendocrine Associate 35590107
★☆☆☆☆
Found in Text Mining only
Carcinoma Non Small Cell Lung Stimulate 27650486
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Associate 37821882
★☆☆☆☆
Found in Text Mining only
Drug Related Side Effects and Adverse Reactions Associate 30362321
★☆☆☆☆
Found in Text Mining only
Esophageal Squamous Cell Carcinoma Associate 27453415
★☆☆☆☆
Found in Text Mining only
Glioma Associate 32271436
★☆☆☆☆
Found in Text Mining only
Laryngeal Neoplasms Stimulate 26063961
★☆☆☆☆
Found in Text Mining only
Neoplasms Associate 21328542, 24156016, 26063961, 27650486, 27672107, 30361900, 30613307, 33246486, 37686244
★☆☆☆☆
Found in Text Mining only
Ovarian Neoplasms Associate 33246486
★☆☆☆☆
Found in Text Mining only