Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	8013
Gene name	Nuclear receptor subfamily 4 group A member 3
Gene symbol	NR4A3
Synonyms (NCBI Gene)	CHNCSMFMINORNOR1
Chromosome	9
Chromosome location	9q31.1
Summary	This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. The encoded protein may act as a transcriptional activator. The protein can efficiently bind the NGFI-B Response Element (NBRE). Three different versions of extraskel

121

Show/Hide all (121)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022644	hsa-miR-124-3p	Microarray	18668037
MIRT025586	hsa-miR-10b-5p	Reporter assay	21642433
MIRT029401	hsa-miR-26b-5p	Microarray	19088304
MIRT701365	hsa-miR-654-3p	HITS-CLIP	23313552
MIRT701364	hsa-miR-6828-5p	HITS-CLIP	23313552
MIRT701363	hsa-miR-671-5p	HITS-CLIP	23313552
MIRT701362	hsa-miR-2052	HITS-CLIP	23313552
MIRT701361	hsa-miR-19a-5p	HITS-CLIP	23313552
MIRT701360	hsa-miR-19b-1-5p	HITS-CLIP	23313552
MIRT701359	hsa-miR-19b-2-5p	HITS-CLIP	23313552
MIRT701358	hsa-miR-5701	HITS-CLIP	23313552
MIRT701357	hsa-miR-5590-5p	HITS-CLIP	23313552
MIRT701356	hsa-miR-4659a-5p	HITS-CLIP	23313552
MIRT701355	hsa-miR-4659b-5p	HITS-CLIP	23313552
MIRT701354	hsa-miR-6079	HITS-CLIP	23313552
MIRT701353	hsa-miR-4776-3p	HITS-CLIP	23313552
MIRT701352	hsa-miR-3154	HITS-CLIP	23313552
MIRT701350	hsa-miR-6819-3p	HITS-CLIP	23313552
MIRT701351	hsa-miR-6877-3p	HITS-CLIP	23313552
MIRT701349	hsa-miR-9500	HITS-CLIP	23313552
MIRT701348	hsa-miR-196b-3p	HITS-CLIP	23313552
MIRT701347	hsa-miR-6728-3p	HITS-CLIP	23313552
MIRT701346	hsa-miR-7515	HITS-CLIP	23313552
MIRT701345	hsa-miR-369-5p	HITS-CLIP	23313552
MIRT701344	hsa-miR-4747-5p	HITS-CLIP	23313552
MIRT701343	hsa-miR-5196-5p	HITS-CLIP	23313552
MIRT701342	hsa-miR-638	HITS-CLIP	23313552
MIRT701341	hsa-miR-4777-3p	HITS-CLIP	23313552
MIRT735916	hsa-miR-508-3p	Luciferase reporter assayWestern blottingImmunofluorescenceqRT-PCR	33942991
MIRT701365	hsa-miR-654-3p	HITS-CLIP	23313552
MIRT701364	hsa-miR-6828-5p	HITS-CLIP	23313552
MIRT701363	hsa-miR-671-5p	HITS-CLIP	23313552
MIRT701362	hsa-miR-2052	HITS-CLIP	23313552
MIRT701361	hsa-miR-19a-5p	HITS-CLIP	23313552
MIRT701360	hsa-miR-19b-1-5p	HITS-CLIP	23313552
MIRT701359	hsa-miR-19b-2-5p	HITS-CLIP	23313552
MIRT701358	hsa-miR-5701	HITS-CLIP	23313552
MIRT701357	hsa-miR-5590-5p	HITS-CLIP	23313552
MIRT701356	hsa-miR-4659a-5p	HITS-CLIP	23313552
MIRT701355	hsa-miR-4659b-5p	HITS-CLIP	23313552
MIRT701354	hsa-miR-6079	HITS-CLIP	23313552
MIRT701353	hsa-miR-4776-3p	HITS-CLIP	23313552
MIRT701352	hsa-miR-3154	HITS-CLIP	23313552
MIRT701350	hsa-miR-6819-3p	HITS-CLIP	23313552
MIRT701351	hsa-miR-6877-3p	HITS-CLIP	23313552
MIRT701349	hsa-miR-9500	HITS-CLIP	23313552
MIRT701348	hsa-miR-196b-3p	HITS-CLIP	23313552
MIRT701347	hsa-miR-6728-3p	HITS-CLIP	23313552
MIRT701346	hsa-miR-7515	HITS-CLIP	23313552
MIRT701345	hsa-miR-369-5p	HITS-CLIP	23313552
MIRT701344	hsa-miR-4747-5p	HITS-CLIP	23313552
MIRT701343	hsa-miR-5196-5p	HITS-CLIP	23313552
MIRT701342	hsa-miR-638	HITS-CLIP	23313552
MIRT701341	hsa-miR-4777-3p	HITS-CLIP	23313552
MIRT1192930	hsa-miR-1179	CLIP-seq
MIRT1192931	hsa-miR-1208	CLIP-seq
MIRT1192932	hsa-miR-1238	CLIP-seq
MIRT1192933	hsa-miR-1264	CLIP-seq
MIRT1192934	hsa-miR-140-3p	CLIP-seq
MIRT1192935	hsa-miR-224	CLIP-seq
MIRT1192936	hsa-miR-28-3p	CLIP-seq
MIRT1192937	hsa-miR-3074-5p	CLIP-seq
MIRT1192938	hsa-miR-3140-3p	CLIP-seq
MIRT1192939	hsa-miR-335	CLIP-seq
MIRT1192940	hsa-miR-3691-3p	CLIP-seq
MIRT1192941	hsa-miR-370	CLIP-seq
MIRT1192942	hsa-miR-3713	CLIP-seq
MIRT1192943	hsa-miR-374a	CLIP-seq
MIRT1192944	hsa-miR-374b	CLIP-seq
MIRT1192945	hsa-miR-4258	CLIP-seq
MIRT1192946	hsa-miR-4455	CLIP-seq
MIRT1192947	hsa-miR-4476	CLIP-seq
MIRT1192948	hsa-miR-4477b	CLIP-seq
MIRT1192949	hsa-miR-4502	CLIP-seq
MIRT1192950	hsa-miR-4533	CLIP-seq
MIRT1192951	hsa-miR-4731-5p	CLIP-seq
MIRT1192952	hsa-miR-548c-3p	CLIP-seq
MIRT1192953	hsa-miR-607	CLIP-seq
MIRT1192954	hsa-miR-609	CLIP-seq
MIRT1192930	hsa-miR-1179	CLIP-seq
MIRT1192931	hsa-miR-1208	CLIP-seq
MIRT1192935	hsa-miR-224	CLIP-seq
MIRT1192937	hsa-miR-3074-5p	CLIP-seq
MIRT1192955	hsa-miR-320a	CLIP-seq
MIRT1192956	hsa-miR-320b	CLIP-seq
MIRT1192957	hsa-miR-320c	CLIP-seq
MIRT1192958	hsa-miR-320d	CLIP-seq
MIRT1192959	hsa-miR-340	CLIP-seq
MIRT1192960	hsa-miR-3662	CLIP-seq
MIRT1192940	hsa-miR-3691-3p	CLIP-seq
MIRT1192941	hsa-miR-370	CLIP-seq
MIRT1192942	hsa-miR-3713	CLIP-seq
MIRT1192961	hsa-miR-380	CLIP-seq
MIRT1192962	hsa-miR-4429	CLIP-seq
MIRT1192947	hsa-miR-4476	CLIP-seq
MIRT1192948	hsa-miR-4477b	CLIP-seq
MIRT1192963	hsa-miR-4495	CLIP-seq
MIRT1192964	hsa-miR-4528	CLIP-seq
MIRT1192950	hsa-miR-4533	CLIP-seq
MIRT1192951	hsa-miR-4731-5p	CLIP-seq
MIRT1192965	hsa-miR-490-3p	CLIP-seq
MIRT1192966	hsa-miR-495	CLIP-seq
MIRT1192967	hsa-miR-548ae	CLIP-seq
MIRT1192968	hsa-miR-548aj	CLIP-seq
MIRT1192969	hsa-miR-548am	CLIP-seq
MIRT1192970	hsa-miR-548x	CLIP-seq
MIRT1192971	hsa-miR-642b	CLIP-seq
MIRT1192972	hsa-miR-649	CLIP-seq
MIRT2056022	hsa-miR-181a	CLIP-seq
MIRT2056023	hsa-miR-181b	CLIP-seq
MIRT2056024	hsa-miR-181c	CLIP-seq
MIRT2056025	hsa-miR-181d	CLIP-seq
MIRT2056026	hsa-miR-4262	CLIP-seq
MIRT1192965	hsa-miR-490-3p	CLIP-seq
MIRT1192972	hsa-miR-649	CLIP-seq
MIRT2284676	hsa-miR-144	CLIP-seq
MIRT2284677	hsa-miR-4263	CLIP-seq
MIRT2284678	hsa-miR-4735-5p	CLIP-seq
MIRT2284679	hsa-miR-501-3p	CLIP-seq
MIRT2284680	hsa-miR-502-3p	CLIP-seq
MIRT2284681	hsa-miR-576-5p	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
CREB1	Unknown	10701778
TLX1	Activation	15384172

Show/Hide all (97)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001216	Function	DNA-binding transcription activator activity	IEA
GO:0001223	Function	Transcription coactivator binding	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	20558821
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001707	Process	Mesoderm formation	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	NAS	8634690
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003707	Function	Nuclear steroid receptor activity	TAS	8570200
GO:0004879	Function	Nuclear receptor activity	IEA
GO:0004879	Function	Nuclear receptor activity	TAS	8570200
GO:0005515	Function	Protein binding	IPI	12543801, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	8634690
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IBA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007369	Process	Gastrulation	IEA
GO:0007369	Process	Gastrulation	ISS
GO:0007411	Process	Axon guidance	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010613	Process	Positive regulation of cardiac muscle hypertrophy	ISS
GO:0010828	Process	Positive regulation of D-glucose transmembrane transport	IDA	24022864
GO:0019901	Function	Protein kinase binding	IPI	25852083
GO:0021766	Process	Hippocampus development	IEA
GO:0030518	Process	Nuclear receptor-mediated steroid hormone signaling pathway	IEA
GO:0030522	Process	Intracellular receptor signaling pathway	IEA
GO:0030534	Process	Adult behavior	IEA
GO:0032765	Process	Positive regulation of mast cell cytokine production	IEA
GO:0032765	Process	Positive regulation of mast cell cytokine production	ISS
GO:0034390	Process	Smooth muscle cell apoptotic process	IEA
GO:0034392	Process	Negative regulation of smooth muscle cell apoptotic process	IEA
GO:0035035	Function	Histone acetyltransferase binding	IEA
GO:0035259	Function	Nuclear glucocorticoid receptor binding	IBA
GO:0035497	Function	CAMP response element binding	IEA
GO:0035497	Function	CAMP response element binding	ISS
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035556	Process	Intracellular signal transduction	ISS
GO:0035726	Process	Common myeloid progenitor cell proliferation	IEA
GO:0035726	Process	Common myeloid progenitor cell proliferation	ISS
GO:0038097	Process	Positive regulation of mast cell activation by Fc-epsilon receptor signaling pathway	IEA
GO:0038097	Process	Positive regulation of mast cell activation by Fc-epsilon receptor signaling pathway	ISS
GO:0042472	Process	Inner ear morphogenesis	IEA
GO:0042542	Process	Response to hydrogen peroxide	IEA
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0043303	Process	Mast cell degranulation	IEA
GO:0043303	Process	Mast cell degranulation	ISS
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0044320	Process	Cellular response to leptin stimulus	IEA
GO:0044320	Process	Cellular response to leptin stimulus	ISS
GO:0045333	Process	Cellular respiration	IEA
GO:0045333	Process	Cellular respiration	ISS
GO:0045444	Process	Fat cell differentiation	IEA
GO:0045444	Process	Fat cell differentiation	ISS
GO:0045787	Process	Positive regulation of cell cycle	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	20558821
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	IDA	23554459
GO:0048660	Process	Regulation of smooth muscle cell proliferation	IDA	25852083
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IEA
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	ISS
GO:0048752	Process	Semicircular canal morphogenesis	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	ISS
GO:0050885	Process	Neuromuscular process controlling balance	IEA
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0060005	Process	Vestibular reflex	IEA
GO:0061469	Process	Regulation of type B pancreatic cell proliferation	ISS
GO:0071376	Process	Cellular response to corticotropin-releasing hormone stimulus	IBA
GO:0071376	Process	Cellular response to corticotropin-releasing hormone stimulus	IEA
GO:0071376	Process	Cellular response to corticotropin-releasing hormone stimulus	ISS
GO:0071870	Process	Cellular response to catecholamine stimulus	IEA
GO:0071870	Process	Cellular response to catecholamine stimulus	ISS
GO:0097009	Process	Energy homeostasis	IEA
GO:0097009	Process	Energy homeostasis	ISS
GO:0097048	Process	Dendritic cell apoptotic process	IEA
GO:1900625	Process	Positive regulation of monocyte aggregation	IEA
GO:1900625	Process	Positive regulation of monocyte aggregation	IMP	20558821
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IGI	23554459
GO:1904754	Process	Positive regulation of vascular associated smooth muscle cell migration	IGI	23554459
GO:2000253	Process	Positive regulation of feeding behavior	IEA
GO:2000253	Process	Positive regulation of feeding behavior	ISS
GO:2000670	Process	Positive regulation of dendritic cell apoptotic process	IEA

MIM	HGNC	e!Ensembl
600542	7982	ENSG00000119508

Q92570

Protein name

Nuclear receptor subfamily 4 group A member 3 (Mitogen-induced nuclear orphan receptor) (Neuron-derived orphan receptor 1) (Nuclear hormone receptor NOR-1) (Translocated in extraskeletal chondrosarcoma)

Protein function

Transcriptional activator that binds to regulatory elements in promoter regions in a cell- and response element (target)-specific manner. Induces gene expression by binding as monomers to the NR4A1 response element (NBRE) 5'-AAAAGGTCA-3' site an

PDB

8XTT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00105	zf-C4	290 → 359	Zinc finger, C4 type (two domains)	Domain
PF00104	Hormone_recep	429 → 607	Ligand-binding domain of nuclear hormone receptor	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform alpha is highly expressed in skeletal muscle. Isoform beta is highly expressed in skeletal muscle and low expressed in fetal brain and placenta.

Sequence

MPCVQAQYSPSPPGSSYAAQTYSSEYTTEIMNPDYTKLTMDLGSTEITATATTSLPSIST
FVEGYSSNYELKPSCVYQMQRPLIKVEEGRAPSYHHHHHHHHHHHHHHQQQHQQPSIPPA
SSPEDEVLPSTSMYFKQSPPSTPTTPAFPPQAGALWDEALPSAPGCIAPGPLLDPPMKAV
PTVAGARFPLFHFKPSPPHPPAPSPAGGHHLGYDPTAAAALSLPLGAAAAAGSQAAALES
HPYGLPLAKRAAPLAFPPLGLTPSPTASSLLGESPSLPSPPSRSSSSGEGTCAVCGDNAA
CQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLSVGMVKE
VVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMNALVRALTDSTPRDLDYSRYC
PTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFVL
RLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFSLNLQSLNLDIQALACLSAL
SMITERHGLKEPKRVEELCNKITSSLKDHQSKGQALEPTESKVLGALVELRKICTLGLQR
IFYLKLEDLVSPPSIIDKLFLDTLPF

Sequence length

626

Interactions

View interactions

	KEGG		Reactome
	Transcriptional misregulation in cancer		Nuclear Receptor transcription pathway RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function

NR4A3 (nuclear receptor subfamily 4 group A member 3)