CCDC170 (coiled-coil domain containing 170)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
80129
Gene name Gene Name - the full gene name approved by the HGNC.
Coiled-coil domain containing 170
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CCDC170
Synonyms (NCBI Gene) Gene synonyms aliases
C6orf97, bA282P11.1
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q25.1
Summary Summary of gene provided in NCBI Entrez Gene.
The function of this gene and its encoded protein is not known. Several genome-wide association studies have implicated the region around this gene to be involved in breast cancer and bone mineral density, but no link to this specific gene has been found.
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(2)
miRTarBase ID miRNA Experiments Reference
MIRT024045 hsa-miR-1-3p Microarray 18668037
MIRT030162 hsa-miR-26b-5p Microarray 19088304
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(5)
GO ID Ontology Definition Evidence Reference
GO:0000226 Process Microtubule cytoskeleton organization IDA 28687497
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005794 Component Golgi apparatus IDA 28687497
GO:0008017 Function Microtubule binding IDA 28687497
GO:0036064 Component Ciliary basal body IDA 29257953
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q8IYT3
Protein name Coiled-coil domain-containing protein 170
Protein function Plays a role in Golgi-associated microtubules organization and stabilization.
Family and domains
Sequence 
MSLDCTSHIALGAASPAPEETYDHLSEVPVTREQLNHYRNVAQNARSELAATLVKFECAQ
SELQDLRSKMLSKEVSCQELKAEMESYKENNARKSSLLTSLRDRVQELEEESAALSTSKI
RTEITAHAAIKENQELKKKVVELNEKLQKCSKENEENKKQVSKNCRKHEEFLTQLRDCLD
PDERNDKASDEDLILKLRDLRKENEFVKGQIVILEETINVHEMEAKASRETIMRLASEVN
REQKKAASCTEEKEKLNQDLLSAVEAKEALEREVKIFQERLLAGQQVWDASKQEVSLLKK
SSSELEKSLKASQDAVTTSQSQYFSFREKIAALLRGRLSMTGSTEDTILEKIREMDSREE
SRDRMVSQLEAQISELVEQLGKESGFHQKALQRAQKAENMLETLQGQLTHLEAELVSGGV
LRDNLNFEKQKYLKFLDQLSQKMKLDQMAAELGFDMRLDVVLARTEQLVRLESNAVIENK
TIAHNLQRKLKTQKERLESKELHMSLLRQKIAQLEEEKQARTALVVERDNAHLTIRNLQK
KVERLQKELNTCRDLHTELKAKLADTNELKIKTLEQTKAIEDLNKSRDQLEKMKEKAEKK
LMSVKSELDTTEHEAKENKERARNMIEVVTSEMKTLKKSLEEAEKREKQLADFREVVSQM
LGLNVTSLALPDYEIIKCLERLVHSHQHHFVTCACLKDVTTGQERHPQGHLQLLH
Sequence length 715
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (4)
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)		 23535729, 23535733, 21263130
Breast carcinoma Breast Carcinoma rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451
View all (71 more)		 27354352, 23535729, 29059683, 21263130, 27117709, 25751625, 29058716
Estrogen resistance ESTROGEN RESISTANCE rs104893956, rs397509428, rs1131692059
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)		 31164008
Show/Hide Unknown Diseases (5)
Unknown
Disease term Disease name Evidence References Source
Endometriosis Endometriosis 28537267 ClinVar, GWAS
Mental depression Major Depressive Disorder 29942085, 31164008 ClinVar
Myeloid Leukemia Myeloid Leukemia These data suggest that Stau2 loss delays myeloid leukemia progression at least in part via accelerated differentiation and reduced proliferation of LSCs. GWAS, CBGDA
Ovarian cancer Ovarian cancer Conditional KD of IL6 in the OCCA xenograft model delays tumor growth GWAS, CBGDA
Show/Hide Text Mining Associations (9)
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Associate 20453838, 20661439, 21552322, 22879957, 23486537, 24127041, 24289300, 25116933, 25370037, 25862352, 27525837, 27848153, 28687497, 28761973, 31125336
View all (6 more)
Carcinogenesis Associate 25370037
Leukemia Myelogenous Chronic BCR ABL Positive Associate 37774059
Neoplasms Associate 25370037
Osteoporosis Associate 35414641, 35511874
Ovarian Neoplasms Associate 37024829
Sarcopenia Associate 32076017
ST Elevation Myocardial Infarction Associate 30382883
Triple Negative Breast Neoplasms Associate 21844186