TRIM46 (tripartite motif containing 46)

Gene

• Entrez ID: 80128
• Gene name: Tripartite motif containing 46
• Gene symbol: TRIM46
• Synonyms (NCBI Gene): GENEY, TRIFIC
• Chromosome: 1
• Chromosome location: 1q22

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1455016	hsa-miR-1225-3p	CLIP-seq
MIRT1455017	hsa-miR-298	CLIP-seq
MIRT1455018	hsa-miR-3147	CLIP-seq
MIRT1455019	hsa-miR-331-3p	CLIP-seq
MIRT1455020	hsa-miR-4253	CLIP-seq
MIRT1455021	hsa-miR-4292	CLIP-seq
MIRT1455022	hsa-miR-4425	CLIP-seq
MIRT1455023	hsa-miR-4706	CLIP-seq
MIRT1455024	hsa-miR-4734	CLIP-seq
MIRT1455025	hsa-miR-4749-5p	CLIP-seq
MIRT1455026	hsa-miR-541	CLIP-seq
MIRT1455027	hsa-miR-604	CLIP-seq
MIRT1455028	hsa-miR-609	CLIP-seq
MIRT1455029	hsa-miR-654-5p	CLIP-seq
MIRT1455030	hsa-miR-744	CLIP-seq
MIRT2136349	hsa-miR-1275	CLIP-seq
MIRT2136350	hsa-miR-22	CLIP-seq
MIRT2136351	hsa-miR-3175	CLIP-seq
MIRT2136352	hsa-miR-421	CLIP-seq
MIRT2136353	hsa-miR-4260	CLIP-seq
MIRT2136354	hsa-miR-4291	CLIP-seq
MIRT2136355	hsa-miR-4310	CLIP-seq
MIRT2136356	hsa-miR-4434	CLIP-seq
MIRT2136357	hsa-miR-4436b-3p	CLIP-seq
MIRT2136358	hsa-miR-4516	CLIP-seq
MIRT2136359	hsa-miR-4525	CLIP-seq
MIRT2136360	hsa-miR-4665-5p	CLIP-seq
MIRT2136361	hsa-miR-4709-5p	CLIP-seq
MIRT2136362	hsa-miR-4723-5p	CLIP-seq
MIRT2136363	hsa-miR-4755-3p	CLIP-seq
MIRT2136364	hsa-miR-625	CLIP-seq
MIRT2357267	hsa-miR-1178	CLIP-seq
MIRT2357268	hsa-miR-3065-3p	CLIP-seq
MIRT2357269	hsa-miR-4650-5p	CLIP-seq
MIRT2357270	hsa-miR-4747-5p	CLIP-seq
MIRT2136349	hsa-miR-1275	CLIP-seq
MIRT2136351	hsa-miR-3175	CLIP-seq
MIRT2136353	hsa-miR-4260	CLIP-seq
MIRT2136356	hsa-miR-4434	CLIP-seq
MIRT2136358	hsa-miR-4516	CLIP-seq
MIRT2136359	hsa-miR-4525	CLIP-seq
MIRT2136360	hsa-miR-4665-5p	CLIP-seq
MIRT2136362	hsa-miR-4723-5p	CLIP-seq
MIRT2136364	hsa-miR-625	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000226	Process	Microtubule cytoskeleton organization	IEA
GO:0001578	Process	Microtubule bundle formation	IBA
GO:0001578	Process	Microtubule bundle formation	IEA
GO:0001764	Process	Neuron migration	IBA
GO:0001764	Process	Neuron migration	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0007409	Process	Axonogenesis	IBA
GO:0007409	Process	Axonogenesis	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0030424	Component	Axon	IEA
GO:0030517	Process	Negative regulation of axon extension	ISS
GO:0032880	Process	Regulation of protein localization	IEA
GO:0032880	Process	Regulation of protein localization	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043194	Component	Axon initial segment	IEA
GO:0044304	Component	Main axon	IBA
GO:0044304	Component	Main axon	IEA
GO:0044304	Component	Main axon	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0048490	Process	Anterograde synaptic vesicle transport	IBA
GO:0048490	Process	Anterograde synaptic vesicle transport	IEA
GO:0099612	Process	Protein localization to axon	IEA
GO:1901953	Process	Positive regulation of anterograde dense core granule transport	ISS
GO:1904115	Component	Axon cytoplasm	IEA
GO:1990769	Component	Proximal neuron projection	IEA

Other IDs

• MIM: 600986
• HGNC: 19019
• e!Ensembl: ENSG00000163462

Protein

• UniProt ID: Q7Z4K8
• Protein name: Tripartite motif-containing protein 46 (Gene Y protein) (GeneY) (Tripartite, fibronectin type-III and C-terminal SPRY motif protein)
• Protein function: Microtubule-associated protein that is involved in the formation of parallel microtubule bundles linked by cross-bridges in the proximal axon. Required for the uniform orientation and maintenance of the parallel microtubule fascicles, which are
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13445	zf-RING_UBOX	33 → 77	RING-type zinc-finger	Domain
  PF00643	zf-B_box	222 → 263	B-box zinc finger	Domain
  PF18568	COS	373 → 422	TRIM C-terminal subgroup One Signature domain	Domain

• Sequence:

  MAEGEDMQTFTSIMDALVRISTSMKNMEKELLCPVCQEMYKQPLVLPCTHNVCQACAREV
  LGQQGYIGHGGDPSSEPTSPASTPSTRSPRLSRRTLPKPDRLDRLLKSGFGTYPGRKRGA
  LHPQVIMFPCPACQGDVELGERGLAGLFRNLTLERVVERYRQSVSVGGAILCQLCKPPPL
  EATKGCTECRATFCNECFKLFHPWGTQKAQHEPTLPTLSFRPKGLMCPDHKEEVTHYCKT
  CQRLVCQLCRVRRTHSGHKITPVLSAYQALKDKLTKSLTYILGNQDTVQTQICELEEAVR
  HTEVSGQQAKEEVSQLVRGLGAVLEEKRASLLQAIEECQQERLARLSAQIQEHRSLLDGS
  GLVGYAQEVLKETDQPCFVQAAKQLHNRIARATEALQTFRPAASSSFRHCQLDVGREMKL
  LTELNFLRVPEAPVIDTQRTFAYDQIFLCWRLPPHSPPAWHYTVEFRRTDVPAQPGPTRW
  QRREEVRGTSALLENPDTGSVYVLRVRGCNKAGYGEYSEDVHLHTPPAPVLHFFLDSRWG
  ASRERLAISKDQRAVRSVPGLPLLLAADRLLTGCHLSVDVVLGDVAVTQGRSYWACAVDP
  ASYLVKVGVGLESKLQESFQGAPDVISPRYDPDSGHDSGAEDATVEASPPFAFLTIGMGK
  ILLGSGASSNAGLTGRDGPTAGCTVPLPPRLGICLDYERGRVSFLDAVSFRGLLECPLDC
  SGPVCPAFCFIGGGAVQLQEPVGTKPERKVTIGGFAKLD

• Sequence length: 759

Pathways

Reactome:

Interferon gamma signaling

<

Associated diseases

Unknown
Disease merge term	Disease name	Evidence	References	Source
Breast Cancer	Breast cancer	N/A	N/A	GWAS
Dental caries	Dental caries	N/A	N/A	GWAS
Gout	Gout	N/A	N/A	GWAS
Parkinson disease	Parkinson disease	N/A	N/A	GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Adenocarcinoma of Lung	Associate	35354796
Asymptomatic Diseases	Associate	36221101
Breast Neoplasms	Associate	34459501
Carcinoma Non Small Cell Lung	Inhibit	26599082
Diabetic Retinopathy	Associate	34487731
Esophageal Neoplasms	Associate	29028942
Gout	Associate	28252667, 36221101
Hereditary Breast and Ovarian Cancer Syndrome	Associate	34459501
Lung Neoplasms	Associate	35354796
Metabolic Syndrome	Associate	34638981
Mohr Tranebjaerg syndrome	Stimulate	35354796
Neoplasms	Associate	29028942, 34459501, 38095640
Pancreatic Neoplasms	Associate	38095640
Stomach Diseases	Associate	37652501
Stomach Neoplasms	Associate	22938426, 29028942, 37652501