MZT2B (mitotic spindle organizing protein 2B)

Gene

• Entrez ID: 80097
• Gene name: Mitotic spindle organizing protein 2B
• Gene symbol: MZT2B
• Synonyms (NCBI Gene): FAM128B, MOZART2B
• Chromosome: 2
• Chromosome location: 2q21.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT045174	hsa-miR-186-5p	CLASH	23622248
MIRT042318	hsa-miR-484	CLASH	23622248
MIRT1170811	hsa-miR-1252	CLIP-seq
MIRT1170812	hsa-miR-3173-3p	CLIP-seq
MIRT1170813	hsa-miR-3614-3p	CLIP-seq
MIRT1170814	hsa-miR-4330	CLIP-seq
MIRT1170815	hsa-miR-4795-3p	CLIP-seq
MIRT1170811	hsa-miR-1252	CLIP-seq
MIRT2049227	hsa-miR-3121-5p	CLIP-seq
MIRT2049228	hsa-miR-3144-5p	CLIP-seq
MIRT1170812	hsa-miR-3173-3p	CLIP-seq
MIRT2049229	hsa-miR-3191	CLIP-seq
MIRT1170813	hsa-miR-3614-3p	CLIP-seq
MIRT1170814	hsa-miR-4330	CLIP-seq
MIRT2049230	hsa-miR-4652-5p	CLIP-seq
MIRT2049231	hsa-miR-4667-5p	CLIP-seq
MIRT2049232	hsa-miR-4700-5p	CLIP-seq
MIRT2049233	hsa-miR-4731-5p	CLIP-seq
MIRT1170815	hsa-miR-4795-3p	CLIP-seq
MIRT1170811	hsa-miR-1252	CLIP-seq
MIRT1170812	hsa-miR-3173-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000931	Component	Gamma-tubulin ring complex	IDA	20360068
GO:0005515	Function	Protein binding	IPI	20360068, 28514442, 29568061, 33961781
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IBA
GO:0005813	Component	Centrosome	IDA	20360068, 21399614
GO:0005813	Component	Centrosome	IEA
GO:0005819	Component	Spindle	IBA
GO:0005819	Component	Spindle	IDA	20360068
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA

Other IDs

• MIM: 613450
• HGNC: 25886
• e!Ensembl: ENSG00000152082

Protein

• UniProt ID: Q6NZ67
• Protein name: Mitotic-spindle organizing protein 2B (Mitotic-spindle organizing protein associated with a ring of gamma-tubulin 2B)
• Protein function: Required for the recruitment and the assembly of the gamma-tubulin ring complex (gTuRC) at the centrosome (PubMed:20360068, PubMed:39321809). The gTuRC regulates the minus-end nucleation of alpha-beta tubulin heterodimers that grow into microtub
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12926	MOZART2	8 → 96	Mitotic-spindle organizing gamma-tubulin ring associated	Family

• Sequence:

  MAAQGVGPGPGSAAPPGLEAARQKLALRRKKVLSTEEMELYELAQAAGGAIDPDVFKILV
  DLLKLNVAPLAVFQMLKSMCAGQRLASEPQDPAAVSLPTSSVPETRGRNKGSAALGGALA
  LAERSSREGSSQRMPRQPSATRLPKGGGPGKSPTRGST

• Sequence length: 158

Pathways

Reactome:

Recruitment of mitotic centrosome proteins and complexes
Recruitment of NuMA to mitotic centrosomes

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CONGENITAL MICROCEPHALY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOBAL DEVELOPMENTAL DELAY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LISSENCEPHALY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Neoplasm Metastasis	Associate	33351778	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	33351778	★☆☆☆☆ Found in Text Mining only