Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	79971
Gene name	Wnt ligand secretion mediator
Gene symbol	WLS
Synonyms (NCBI Gene)	C1orf139EVIGPR177MRPZKSmig-14
Chromosome	1
Chromosome location	1p31.3

123

Show/Hide all (123)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023503	hsa-miR-1-3p	Proteomics	18668040
MIRT028895	hsa-miR-26b-5p	Microarray	19088304
MIRT032212	hsa-let-7b-5p	Proteomics	18668040
MIRT044935	hsa-miR-186-5p	CLASH	23622248
MIRT531926	hsa-miR-4678	PAR-CLIP	22012620
MIRT531925	hsa-miR-6793-3p	PAR-CLIP	22012620
MIRT531923	hsa-miR-3682-3p	PAR-CLIP	22012620
MIRT531924	hsa-miR-331-5p	PAR-CLIP	22012620
MIRT737281	hsa-miR-31-3p	Luciferase reporter assayWestern blottingqRT-PCRFlow cytometry	33007980
MIRT531926	hsa-miR-4678	PAR-CLIP	22012620
MIRT531925	hsa-miR-6793-3p	PAR-CLIP	22012620
MIRT531923	hsa-miR-3682-3p	PAR-CLIP	22012620
MIRT531924	hsa-miR-331-5p	PAR-CLIP	22012620
MIRT1493270	hsa-miR-1827	CLIP-seq
MIRT1493271	hsa-miR-579	CLIP-seq
MIRT1493272	hsa-miR-664	CLIP-seq
MIRT1493273	hsa-miR-1286	CLIP-seq
MIRT1493274	hsa-miR-4691-5p	CLIP-seq
MIRT1493275	hsa-miR-4722-5p	CLIP-seq
MIRT2148721	hsa-miR-140-3p	CLIP-seq
MIRT2463508	hsa-miR-3646	CLIP-seq
MIRT2463509	hsa-miR-3659	CLIP-seq
MIRT2463510	hsa-miR-4484	CLIP-seq
MIRT2463511	hsa-miR-4658	CLIP-seq
MIRT2463512	hsa-miR-548an	CLIP-seq
MIRT2463513	hsa-miR-574-5p	CLIP-seq
MIRT2463514	hsa-miR-577	CLIP-seq
MIRT2463508	hsa-miR-3646	CLIP-seq
MIRT2463509	hsa-miR-3659	CLIP-seq
MIRT2463510	hsa-miR-4484	CLIP-seq
MIRT2463511	hsa-miR-4658	CLIP-seq
MIRT2463512	hsa-miR-548an	CLIP-seq
MIRT2463513	hsa-miR-574-5p	CLIP-seq
MIRT2463514	hsa-miR-577	CLIP-seq
MIRT2662694	hsa-miR-1184	CLIP-seq
MIRT2662695	hsa-miR-1226	CLIP-seq
MIRT2662696	hsa-miR-1265	CLIP-seq
MIRT2662697	hsa-miR-1269	CLIP-seq
MIRT2662698	hsa-miR-1269b	CLIP-seq
MIRT2662699	hsa-miR-1288	CLIP-seq
MIRT2148721	hsa-miR-140-3p	CLIP-seq
MIRT1493270	hsa-miR-1827	CLIP-seq
MIRT2662700	hsa-miR-185	CLIP-seq
MIRT2662701	hsa-miR-3128	CLIP-seq
MIRT2662702	hsa-miR-3136-3p	CLIP-seq
MIRT2662703	hsa-miR-3148	CLIP-seq
MIRT2662704	hsa-miR-3184	CLIP-seq
MIRT2662705	hsa-miR-3200-3p	CLIP-seq
MIRT2662706	hsa-miR-326	CLIP-seq
MIRT2662707	hsa-miR-330-5p	CLIP-seq
MIRT2662708	hsa-miR-361-3p	CLIP-seq
MIRT2662709	hsa-miR-3622b-5p	CLIP-seq
MIRT2662710	hsa-miR-3649	CLIP-seq
MIRT2662711	hsa-miR-3670	CLIP-seq
MIRT2662712	hsa-miR-3671	CLIP-seq
MIRT2662713	hsa-miR-423-5p	CLIP-seq
MIRT2662714	hsa-miR-4286	CLIP-seq
MIRT2662715	hsa-miR-4306	CLIP-seq
MIRT2662716	hsa-miR-4436b-5p	CLIP-seq
MIRT2662717	hsa-miR-4492	CLIP-seq
MIRT2662718	hsa-miR-4498	CLIP-seq
MIRT2662719	hsa-miR-4505	CLIP-seq
MIRT2662720	hsa-miR-4515	CLIP-seq
MIRT2662721	hsa-miR-4529-3p	CLIP-seq
MIRT2662722	hsa-miR-4644	CLIP-seq
MIRT2662723	hsa-miR-4665-3p	CLIP-seq
MIRT2662724	hsa-miR-4668-3p	CLIP-seq
MIRT2662725	hsa-miR-4720-5p	CLIP-seq
MIRT2662726	hsa-miR-4731-5p	CLIP-seq
MIRT2662727	hsa-miR-4740-5p	CLIP-seq
MIRT2662728	hsa-miR-4799-3p	CLIP-seq
MIRT2662729	hsa-miR-4802-5p	CLIP-seq
MIRT1493271	hsa-miR-579	CLIP-seq
MIRT2662730	hsa-miR-592	CLIP-seq
MIRT2662731	hsa-miR-597	CLIP-seq
MIRT1493272	hsa-miR-664	CLIP-seq
MIRT2662732	hsa-miR-668	CLIP-seq
MIRT2662733	hsa-miR-762	CLIP-seq
MIRT2662734	hsa-miR-877	CLIP-seq
MIRT2662695	hsa-miR-1226	CLIP-seq
MIRT2662696	hsa-miR-1265	CLIP-seq
MIRT2662697	hsa-miR-1269	CLIP-seq
MIRT2662698	hsa-miR-1269b	CLIP-seq
MIRT2662699	hsa-miR-1288	CLIP-seq
MIRT2148721	hsa-miR-140-3p	CLIP-seq
MIRT1493270	hsa-miR-1827	CLIP-seq
MIRT2662700	hsa-miR-185	CLIP-seq
MIRT2662701	hsa-miR-3128	CLIP-seq
MIRT2662702	hsa-miR-3136-3p	CLIP-seq
MIRT2662703	hsa-miR-3148	CLIP-seq
MIRT2662704	hsa-miR-3184	CLIP-seq
MIRT2662705	hsa-miR-3200-3p	CLIP-seq
MIRT2662706	hsa-miR-326	CLIP-seq
MIRT2662707	hsa-miR-330-5p	CLIP-seq
MIRT2662708	hsa-miR-361-3p	CLIP-seq
MIRT2662709	hsa-miR-3622b-5p	CLIP-seq
MIRT2662710	hsa-miR-3649	CLIP-seq
MIRT2662711	hsa-miR-3670	CLIP-seq
MIRT2662712	hsa-miR-3671	CLIP-seq
MIRT2662713	hsa-miR-423-5p	CLIP-seq
MIRT2662714	hsa-miR-4286	CLIP-seq
MIRT2662715	hsa-miR-4306	CLIP-seq
MIRT2662716	hsa-miR-4436b-5p	CLIP-seq
MIRT2662717	hsa-miR-4492	CLIP-seq
MIRT2662718	hsa-miR-4498	CLIP-seq
MIRT2662719	hsa-miR-4505	CLIP-seq
MIRT2662720	hsa-miR-4515	CLIP-seq
MIRT2662721	hsa-miR-4529-3p	CLIP-seq
MIRT2662722	hsa-miR-4644	CLIP-seq
MIRT2662723	hsa-miR-4665-3p	CLIP-seq
MIRT2662724	hsa-miR-4668-3p	CLIP-seq
MIRT2662725	hsa-miR-4720-5p	CLIP-seq
MIRT2662726	hsa-miR-4731-5p	CLIP-seq
MIRT2662727	hsa-miR-4740-5p	CLIP-seq
MIRT2662728	hsa-miR-4799-3p	CLIP-seq
MIRT2662729	hsa-miR-4802-5p	CLIP-seq
MIRT1493271	hsa-miR-579	CLIP-seq
MIRT2662730	hsa-miR-592	CLIP-seq
MIRT2662731	hsa-miR-597	CLIP-seq
MIRT1493272	hsa-miR-664	CLIP-seq
MIRT2662732	hsa-miR-668	CLIP-seq
MIRT2662733	hsa-miR-762	CLIP-seq
MIRT2662734	hsa-miR-877	CLIP-seq

Show/Hide all (51)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IDA	24768165
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0001707	Process	Mesoderm formation	IEA
GO:0005515	Function	Protein binding	IPI	18160348, 20214800, 22784633, 23840749, 24768165, 28298427, 28734904, 31286866, 33961781
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IDA	18160348
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	24768165
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IDA	16678095
GO:0005794	Component	Golgi apparatus	IEA
GO:0005802	Component	Trans-Golgi network	IDA	18160348
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA	18160348, 24768165
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006886	Process	Intracellular protein transport	IBA
GO:0006886	Process	Intracellular protein transport	IMP	16678095
GO:0009948	Process	Anterior/posterior axis specification	IEA
GO:0009948	Process	Anterior/posterior axis specification	ISS
GO:0012505	Component	Endomembrane system	IBA
GO:0016020	Component	Membrane	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0017147	Function	Wnt-protein binding	IBA
GO:0017147	Function	Wnt-protein binding	IEA
GO:0017147	Function	Wnt-protein binding	IPI	24768165
GO:0017147	Function	Wnt-protein binding	ISS	16678095
GO:0030177	Process	Positive regulation of Wnt signaling pathway	IMP	16678095, 16678096
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0030901	Process	Midbrain development	IEA
GO:0030902	Process	Hindbrain development	IEA
GO:0031017	Process	Exocrine pancreas development	IEA
GO:0031090	Component	Organelle membrane	IBA
GO:0031410	Component	Cytoplasmic vesicle	IDA	16678095, 24768165
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031901	Component	Early endosome membrane	IEA
GO:0031901	Component	Early endosome membrane	TAS
GO:0042802	Function	Identical protein binding	IPI	28734904
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	ISS
GO:0061355	Process	Wnt protein secretion	IBA
GO:0061355	Process	Wnt protein secretion	IEA
GO:0061355	Process	Wnt protein secretion	IMP	24768165
GO:0061357	Process	Positive regulation of Wnt protein secretion	IMP	16678095
GO:0061357	Process	Positive regulation of Wnt protein secretion	ISS	16678096
GO:0070062	Component	Extracellular exosome	TAS
GO:0071529	Process	Cementum mineralization	IEA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IEA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IMP	17804805

MIM	HGNC	e!Ensembl
611514	30238	ENSG00000116729

Q5T9L3

Protein name

Protein wntless homolog (Integral membrane protein GPR177) (Protein evenness interrupted homolog) (EVI) (Putative NF-kappa-B-activating protein 373)

Protein function

Regulates Wnt proteins sorting and secretion in a feedback regulatory mechanism. This reciprocal interaction plays a key role in the regulation of expression, subcellular location, binding and organelle-specific association of Wnt proteins (PubM

PDB

7DRT , 7KC4 , 8TZO , 8TZP , 8TZR , 8TZS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06664	MIG-14_Wnt-bd	178 → 496		Family

Sequence

MAGAIIENMSTKKLCIVGGILLVFQIIAFLVGGLIAPGPTTAVSYMSVKCVDARKNHHKT
KWFVPWGPNHCDKIRDIEEAIPREIEANDIVFSVHIPLPHMEMSPWFQFMLFILQLDIAF
KLNNQIRENAEVSMDVSLAYRDDAFAEWTEMAHERVPRKLKCTFTSPKTPEHEGRYYECD
VLPFMEIGSVAHKFYLLNIRLPVNEKKKINVGIGEIKDIRLVGIHQNGGFTKVWFAMKTF
LTPSIFIIMVWYWRRITMMSRPPVLLEKVIFALGISMTFINIPVEWFSIGFDWTWMLLFG
DIRQGIFYAMLLSFWIIFCGEHMMDQHERNHIAGYWKQVGPIAVGSFCLFIFDMCERGVQ
LTNPFYSIWTTDIGTELAMAFIIVAGICLCLYFLFLCFMVFQVFRNISGKQSSLPAMSKV
RRLHYEGLIFRFKFLMLITLACAAMTVIFFIVSQVTEGHWKWGGVTVQVNSAFFTGIYGM
WNLYVFALMFLYAPSHKNYGEDQSNGDLGVHSGEELQLTTTITHVDGPTEIYKLTRKEAQ
E

Sequence length

541

Interactions

View interactions

	Reactome
			WNT ligand biogenesis and trafficking

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
WLS syndrome	Likely pathogenic; Pathogenic	rs773311381, rs2100377758, rs985347096, rs2100452147	RCV001420504 RCV001420503 RCV001420502 RCV001420501	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Zaki syndrome	Likely pathogenic; Pathogenic	rs773311381, rs2100377758, rs985347096, rs2100452147	RCV001788474 RCV001788473 RCV001789704 RCV001788472	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PREECLAMPSIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WLS-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (18)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	25258105	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Associate	29526886	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Associate	26512113	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	29990993	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Associate	29990993	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	28114350	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Associate	29526886	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neointima	Associate	39769358	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Invasiveness	Associate	29526886	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	29526886	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	29378775, 29526886	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	35131873	★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Nerve Glioma	Associate	25258105	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Associate	25551557	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	25258105	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	23416978	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	35131873	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms Castration Resistant	Associate	35131873	★★★★★ ★☆☆☆☆ Found in Text Mining only

WLS (Wnt ligand secretion mediator)