Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
79969
Gene name Gene Name - the full gene name approved by the HGNC.
Alpha tubulin acetyltransferase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ATAT1
Synonyms (NCBI Gene) Gene synonyms aliases
C6orf134, MEC17, Nbla00487, TAT, alpha-TAT, alpha-TAT1
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.33
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that localizes to clathrin-coated pits, where it acetylates alpha tubulin on lysine 40. This process may be important in microtubule growth, for instance during chemotaxis and the formation of cilium. Alternative splicing resul
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT029620 hsa-miR-26b-5p Microarray 19088304
MIRT004517 hsa-miR-23a-3p Reporter assay 15131085
MIRT048434 hsa-miR-100-5p CLASH 23622248
MIRT038440 hsa-miR-296-3p CLASH 23622248
MIRT628725 hsa-miR-548az-5p HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004468 Function Lysine N-acetyltransferase activity, acting on acetyl phosphate as donor IDA 24906155
GO:0004468 Function Lysine N-acetyltransferase activity, acting on acetyl phosphate as donor TAS
GO:0005794 Component Golgi apparatus IDA
GO:0005829 Component Cytosol IDA
GO:0005829 Component Cytosol TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
615556 21186 ENSG00000137343
Protein
UniProt ID Q5SQI0
Protein name Alpha-tubulin N-acetyltransferase 1 (Alpha-TAT) (Alpha-TAT1) (TAT) (EC 2.3.1.108) (Acetyltransferase mec-17 homolog)
Protein function Specifically acetylates 'Lys-40' in alpha-tubulin on the lumenal side of microtubules. Promotes microtubule destabilization and accelerates microtubule dynamics; this activity may be independent of acetylation activity. Acetylates alpha-tubulin
PDB 3VWD , 3VWE , 4B5O , 4B5P , 4GS4 , 4IF5 , 4PK2 , 4PK3 , 4U9Y , 4U9Z
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05301 Acetyltransf_16 8 190 GNAT acetyltransferase, Mec-17 Family
Sequence
MEFPFDVDALFPERITVLDQHLRPPARRPGTTTPARVDLQQQIMTIIDELGKASAKAQNL
SAPITSASRMQSNRHVVYILKDSSARPAGKGAIIGFIKVGYKKLFVLDDREAHNEVEPLC
ILDFYIHESVQRHGHGRELFQYMLQKERVEPHQLAIDRPSQKLLKFLNKHYNLETTVPQV
NNFVIFEGFF
AHQHRPPAPSLRATRHSRAAAVDPTPAAPARKLPPKRAEGDIKPYSSSDR
EFLKVAVEPPWPLNRAPRRATPPAHPPPRSSSLGNSPERGPLRPFVPEQELLRSLRLCPP
HPTARLLLAADPGGSPAQRRRTRGTPPGLVAQSCCYSRHGGVNSSSPNTGNQDSKQGEQE
TKNRSASEEQALSQDGSGEKPMHTAPPQAPAPPAQSWTVGGDILNARFIRNLQERRSTRP
W
Sequence length 421
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Cilium Assembly
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Prostate cancer Prostate carcinoma, Prostate cancer, familial rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582 29892016
Prostate cancer, hereditary PROSTATE CANCER, HEREDITARY, 1 rs387906327, rs193929331, rs74315365, rs397516896, rs794729219, rs121913349, rs587782641, rs1114167673, rs1597371666, rs2073394466 29892016
Rheumatoid arthritis Rheumatoid Arthritis rs587776843 17804836, 19503088
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)
28540026
Unknown
Disease term Disease name Evidence References Source
Mental Depression Mental Depression GWAS
Associations from Text Mining
Disease Name Relationship Type References
Ameloblastoma Associate 34508164
Lung Neoplasms Associate 30504808
Neoplasm Metastasis Inhibit 30504808
Neoplasms Associate 30504808