ATAT1 (alpha tubulin acetyltransferase 1)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
79969
Gene name Gene Name - the full gene name approved by the HGNC.
Alpha tubulin acetyltransferase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ATAT1
Synonyms (NCBI Gene) Gene synonyms aliases
C6orf134, MEC17, Nbla00487, TAT, alpha-TAT, alpha-TAT1
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.33
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that localizes to clathrin-coated pits, where it acetylates alpha tubulin on lysine 40. This process may be important in microtubule growth, for instance during chemotaxis and the formation of cilium. Alternative splicing resul
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(871)
miRTarBase ID miRNA Experiments Reference
MIRT029620 hsa-miR-26b-5p Microarray 19088304
MIRT004517 hsa-miR-23a-3p Reporter assay 15131085
MIRT048434 hsa-miR-100-5p CLASH 23622248
MIRT038440 hsa-miR-296-3p CLASH 23622248
MIRT628725 hsa-miR-548az-5p HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(40)
GO ID Ontology Definition Evidence Reference
GO:0000226 Process Microtubule cytoskeleton organization IBA
GO:0000226 Process Microtubule cytoskeleton organization IEA
GO:0004468 Function L-lysine N-acetyltransferase activity, acting on acetyl phosphate as donor EXP 23071318
GO:0004468 Function L-lysine N-acetyltransferase activity, acting on acetyl phosphate as donor IDA 24906155
GO:0005515 Function Protein binding IPI 36931259
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
615556 21186 ENSG00000137343
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q5SQI0
Protein name Alpha-tubulin N-acetyltransferase 1 (Alpha-TAT) (Alpha-TAT1) (TAT) (EC 2.3.1.108) (Acetyltransferase mec-17 homolog)
Protein function Specifically acetylates 'Lys-40' in alpha-tubulin on the lumenal side of microtubules. Promotes microtubule destabilization and accelerates microtubule dynamics; this activity may be independent of acetylation activity. Acetylates alpha-tubulin
PDB 3VWD , 3VWE , 4B5O , 4B5P , 4GS4 , 4IF5 , 4PK2 , 4PK3 , 4U9Y , 4U9Z
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05301 Acetyltransf_16 8 → 190 GNAT acetyltransferase, Mec-17 Family
Sequence 
MEFPFDVDALFPERITVLDQHLRPPARRPGTTTPARVDLQQQIMTIIDELGKASAKAQNL
SAPITSASRMQSNRHVVYILKDSSARPAGKGAIIGFIKVGYKKLFVLDDREAHNEVEPLC
ILDFYIHESVQRHGHGRELFQYMLQKERVEPHQLAIDRPSQKLLKFLNKHYNLETTVPQV
NNFVIFEGFFAHQHRPPAPSLRATRHSRAAAVDPTPAAPARKLPPKRAEGDIKPYSSSDR
EFLKVAVEPPWPLNRAPRRATPPAHPPPRSSSLGNSPERGPLRPFVPEQELLRSLRLCPP
HPTARLLLAADPGGSPAQRRRTRGTPPGLVAQSCCYSRHGGVNSSSPNTGNQDSKQGEQE
TKNRSASEEQALSQDGSGEKPMHTAPPQAPAPPAQSWTVGGDILNARFIRNLQERRSTRP
W
Sequence length 421
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Cilium Assembly
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (2)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Mental Depression Major depressive disorder N/A N/A GWAS
Prostate cancer Prostate cancer N/A N/A GWAS
Show/Hide Text Mining Associations (4)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Ameloblastoma Associate 34508164
Lung Neoplasms Associate 30504808
Neoplasm Metastasis Inhibit 30504808
Neoplasms Associate 30504808