Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	79953
Gene name	Synapse differentiation inducing 1
Gene symbol	SYNDIG1
Synonyms (NCBI Gene)	C20orf39DSPC2IFITMD5TMEM90B
Chromosome	20
Chromosome location	20p11.21
Summary	This gene encodes a protein that belongs to the interferon-induced transmembrane family of proteins. A similar protein in rat is thought to regulate the development of excitatory synapses. [provided by RefSeq, Jul 2013]

Show/Hide all (72)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050847	hsa-miR-17-5p	CLASH	23622248
MIRT1405619	hsa-miR-103a	CLIP-seq
MIRT1405620	hsa-miR-107	CLIP-seq
MIRT1405621	hsa-miR-1179	CLIP-seq
MIRT1405622	hsa-miR-1207-5p	CLIP-seq
MIRT1405623	hsa-miR-1269	CLIP-seq
MIRT1405624	hsa-miR-1269b	CLIP-seq
MIRT1405625	hsa-miR-1285	CLIP-seq
MIRT1405626	hsa-miR-1288	CLIP-seq
MIRT1405627	hsa-miR-129-5p	CLIP-seq
MIRT1405628	hsa-miR-15a	CLIP-seq
MIRT1405629	hsa-miR-15b	CLIP-seq
MIRT1405630	hsa-miR-16	CLIP-seq
MIRT1405631	hsa-miR-195	CLIP-seq
MIRT1405632	hsa-miR-2355-3p	CLIP-seq
MIRT1405633	hsa-miR-2467-3p	CLIP-seq
MIRT1405634	hsa-miR-25	CLIP-seq
MIRT1405635	hsa-miR-3121-5p	CLIP-seq
MIRT1405636	hsa-miR-3124-3p	CLIP-seq
MIRT1405637	hsa-miR-3149	CLIP-seq
MIRT1405638	hsa-miR-3158-5p	CLIP-seq
MIRT1405639	hsa-miR-3159	CLIP-seq
MIRT1405640	hsa-miR-3187-5p	CLIP-seq
MIRT1405641	hsa-miR-32	CLIP-seq
MIRT1405642	hsa-miR-3202	CLIP-seq
MIRT1405643	hsa-miR-326	CLIP-seq
MIRT1405644	hsa-miR-330-5p	CLIP-seq
MIRT1405645	hsa-miR-363	CLIP-seq
MIRT1405646	hsa-miR-367	CLIP-seq
MIRT1405647	hsa-miR-3678-3p	CLIP-seq
MIRT1405648	hsa-miR-378g	CLIP-seq
MIRT1405649	hsa-miR-3909	CLIP-seq
MIRT1405650	hsa-miR-424	CLIP-seq
MIRT1405651	hsa-miR-4274	CLIP-seq
MIRT1405652	hsa-miR-4310	CLIP-seq
MIRT1405653	hsa-miR-4325	CLIP-seq
MIRT1405654	hsa-miR-4486	CLIP-seq
MIRT1405655	hsa-miR-4490	CLIP-seq
MIRT1405656	hsa-miR-4503	CLIP-seq
MIRT1405657	hsa-miR-4515	CLIP-seq
MIRT1405658	hsa-miR-4519	CLIP-seq
MIRT1405659	hsa-miR-451b	CLIP-seq
MIRT1405660	hsa-miR-452	CLIP-seq
MIRT1405661	hsa-miR-4520b-3p	CLIP-seq
MIRT1405662	hsa-miR-4524	CLIP-seq
MIRT1405663	hsa-miR-4529-3p	CLIP-seq
MIRT1405664	hsa-miR-4533	CLIP-seq
MIRT1405665	hsa-miR-4676-3p	CLIP-seq
MIRT1405666	hsa-miR-4736	CLIP-seq
MIRT1405667	hsa-miR-4740-5p	CLIP-seq
MIRT1405668	hsa-miR-4763-3p	CLIP-seq
MIRT1405669	hsa-miR-4774-5p	CLIP-seq
MIRT1405670	hsa-miR-4780	CLIP-seq
MIRT1405671	hsa-miR-497	CLIP-seq
MIRT1405672	hsa-miR-568	CLIP-seq
MIRT1405673	hsa-miR-587	CLIP-seq
MIRT1405674	hsa-miR-612	CLIP-seq
MIRT1405675	hsa-miR-623	CLIP-seq
MIRT1405676	hsa-miR-676	CLIP-seq
MIRT1405677	hsa-miR-92a	CLIP-seq
MIRT1405678	hsa-miR-92b	CLIP-seq
MIRT2121639	hsa-miR-1266	CLIP-seq
MIRT2121640	hsa-miR-3194-3p	CLIP-seq
MIRT2121641	hsa-miR-3664-3p	CLIP-seq
MIRT2121642	hsa-miR-4518	CLIP-seq
MIRT1405621	hsa-miR-1179	CLIP-seq
MIRT1405635	hsa-miR-3121-5p	CLIP-seq
MIRT1405636	hsa-miR-3124-3p	CLIP-seq
MIRT1405652	hsa-miR-4310	CLIP-seq
MIRT1405655	hsa-miR-4490	CLIP-seq
MIRT1405656	hsa-miR-4503	CLIP-seq
MIRT1405669	hsa-miR-4774-5p	CLIP-seq

Show/Hide all (42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005768	Component	Endosome	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0006886	Process	Intracellular protein transport	IEA
GO:0006886	Process	Intracellular protein transport	ISS
GO:0014069	Component	Postsynaptic density	IEA
GO:0014069	Component	Postsynaptic density	ISS
GO:0016020	Component	Membrane	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030672	Component	Synaptic vesicle membrane	IBA
GO:0030672	Component	Synaptic vesicle membrane	IEA
GO:0031901	Component	Early endosome membrane	IEA
GO:0031901	Component	Early endosome membrane	ISS
GO:0035254	Function	Glutamate receptor binding	IEA
GO:0035254	Function	Glutamate receptor binding	ISS
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043197	Component	Dendritic spine	IEA
GO:0043197	Component	Dendritic spine	ISS
GO:0043198	Component	Dendritic shaft	IEA
GO:0043198	Component	Dendritic shaft	ISS
GO:0043231	Component	Intracellular membrane-bounded organelle	IBA
GO:0044297	Component	Cell body	IEA
GO:0044297	Component	Cell body	ISS
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0051965	Process	Positive regulation of synapse assembly	IBA
GO:0051965	Process	Positive regulation of synapse assembly	IDA	20152115
GO:0051965	Process	Positive regulation of synapse assembly	IEA
GO:0060076	Component	Excitatory synapse	IBA
GO:0060076	Component	Excitatory synapse	IEA
GO:0060076	Component	Excitatory synapse	ISS
GO:0097091	Process	Synaptic vesicle clustering	IBA
GO:0097091	Process	Synaptic vesicle clustering	IEA
GO:0097091	Process	Synaptic vesicle clustering	ISS
GO:0098839	Component	Postsynaptic density membrane	IBA
GO:0098839	Component	Postsynaptic density membrane	IEA
GO:0098839	Component	Postsynaptic density membrane	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0150052	Process	Regulation of postsynapse assembly	IEA

MIM	HGNC	e!Ensembl
614311	15885	ENSG00000101463

Q9H7V2

Protein name

Synapse differentiation-inducing gene protein 1 (SynDIG1) (Dispanin subfamily C member 2) (DSPC2) (Transmembrane protein 90B)

Protein function

May regulate AMPA receptor content at nascent synapses, and have a role in postsynaptic development and maturation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04505	CD225	177 → 244	Interferon-induced transmembrane protein	Family

Sequence

MDGIIEQKSMLVHSKISDAGKRNGLINTRNLMAESRDGLVSVYPAPQYQSHRVGASTVPA
SLDSSRSEPMQQLLDPNTLQQSVESRYRPNIILYSEGVLRSWGDGVAADCCETTFIEDRS
PTKDSLEYPDGKFIDLSADDIKIHTLSYDVEEEEEFQELESDYSSDTESEDNFLMMPPRD
HLGLSVFSMLCCFWPLGIAAFYLSHETNKAVAKGDLHQASTSSRRALFLAVLSITIGTGV
YVGVAVALIAYLSKNNHL

Sequence length

258

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Colon adenocarcinoma	Uncertain significance	rs373605642	RCV005932696

Show/Hide Text Mining Associations (4)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Alzheimer Disease	Associate	39177846
Breast Neoplasms	Associate	32514046
Depressive Disorder	Associate	22220189
Schizophrenia	Associate	22220189

SYNDIG1 (synapse differentiation inducing 1)