Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
79931
Gene name Gene Name - the full gene name approved by the HGNC.
TNFAIP3 interacting protein 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TNIP3
Synonyms (NCBI Gene) Gene synonyms aliases
ABIN-3, LIND
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q27
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT021541 hsa-miR-142-3p Microarray 17612493
MIRT607161 hsa-miR-8485 HITS-CLIP 22927820
MIRT607160 hsa-miR-4789-3p HITS-CLIP 22927820
MIRT607159 hsa-miR-5580-3p HITS-CLIP 22927820
MIRT607157 hsa-miR-501-3p HITS-CLIP 22927820
Transcription factors
Transcription factor Regulation Reference
NFKB1 Unknown 18081698
RELA Unknown 18081698
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002756 Process MyD88-independent toll-like receptor signaling pathway IDA 17088249
GO:0005515 Function Protein binding IPI 25416956, 31515488, 32296183, 32814053
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol TAS
GO:0006357 Process Regulation of transcription by RNA polymerase II IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608019 19315 ENSG00000050730
Protein
UniProt ID Q96KP6
Protein name TNFAIP3-interacting protein 3 (A20-binding inhibitor of NF-kappa-B activation 3) (ABIN-3) (Listeria-induced gene protein)
Protein function Binds to zinc finger protein TNFAIP3 and inhibits NF-kappa-B activation induced by tumor necrosis factor, Toll-like receptor 4 (TLR4), interleukin-1 and 12-O-tetradecanoylphorbol-13-acetate. Overexpression inhibits NF-kappa-B-dependent gene expr
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16516 CC2-LZ 144 243 Leucine zipper of domain CC2 of NEMO, NF-kappa-B essential modulator Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Highly expressed in lung, lymph node, thymus and fetal liver. Expressed at lower levels in bone marrow, brain, kidney, spleen, leukocytes and tonsils. Could be detected in heart, salivary gland, adrenal gland, pancreas, ovary and fetal
Sequence
MAHFVQGTSRMIAAESSTEHKECAEPSTRKNLMNSLEQKIRCLEKQRKELLEVNQQWDQQ
FRSMKELYERKVAELKTKLDAAERFLSTREKDPHQRQRKDDRQREDDRQRDLTRDRLQRE
EKEKERLNEELHELKEENKLLKGKNTLANKEKEHYECEIKRLNKALQDALNIKCSFSEDC
LRKSRVEFCHEEMRTEMEVLKQQVQIYEEDFKKERSDRERLNQEKEELQQINETSQSQLN
RLN
SQIKACQMEKEKLEKQLKQMYCPPCNCGLVFHLQDPWVPTGPGAVQKQREHPPDYQW
YALDQLPPDVQHKANGLSSVKKVHP
Sequence length 325
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Ovarian tumor domain proteases
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Multiple Sclerosis Multiple sclerosis N/A N/A GWAS
Psoriasis Psoriasis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Colitis Ulcerative Associate 32190668
Inflammation Inhibit 23335080