TNIP3 (TNFAIP3 interacting protein 3)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 79931
Gene name TNFAIP3 interacting protein 3
Gene symbol TNIP3
Synonyms (NCBI Gene)
ABIN-3LIND
Chromosome 4
Chromosome location 4q27
miRNA miRNA information provided by mirtarbase database.
465
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (465)
miRTarBase ID miRNA Experiments Reference
MIRT021541 hsa-miR-142-3p Microarray 17612493
MIRT607161 hsa-miR-8485 HITS-CLIP 22927820
MIRT607160 hsa-miR-4789-3p HITS-CLIP 22927820
MIRT607159 hsa-miR-5580-3p HITS-CLIP 22927820
MIRT607157 hsa-miR-501-3p HITS-CLIP 22927820
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (2)
Transcription factor Regulation Reference
NFKB1 Unknown 18081698
RELA Unknown 18081698
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (12)
GO ID Ontology Definition Evidence Reference
GO:0002756 Process MyD88-independent toll-like receptor signaling pathway IDA 17088249
GO:0005515 Function Protein binding IPI 25416956, 31515488, 32296183, 32814053
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol TAS
GO:0006357 Process Regulation of transcription by RNA polymerase II IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
608019 19315 ENSG00000050730
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96KP6
Protein name TNFAIP3-interacting protein 3 (A20-binding inhibitor of NF-kappa-B activation 3) (ABIN-3) (Listeria-induced gene protein)
Protein function Binds to zinc finger protein TNFAIP3 and inhibits NF-kappa-B activation induced by tumor necrosis factor, Toll-like receptor 4 (TLR4), interleukin-1 and 12-O-tetradecanoylphorbol-13-acetate. Overexpression inhibits NF-kappa-B-dependent gene expr
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16516 CC2-LZ 144 → 243 Leucine zipper of domain CC2 of NEMO, NF-kappa-B essential modulator Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Highly expressed in lung, lymph node, thymus and fetal liver. Expressed at lower levels in bone marrow, brain, kidney, spleen, leukocytes and tonsils. Could be detected in heart, salivary gland, adrenal gland, pancreas, ovary and fetal
Sequence 
MAHFVQGTSRMIAAESSTEHKECAEPSTRKNLMNSLEQKIRCLEKQRKELLEVNQQWDQQ
FRSMKELYERKVAELKTKLDAAERFLSTREKDPHQRQRKDDRQREDDRQRDLTRDRLQRE
EKEKERLNEELHELKEENKLLKGKNTLANKEKEHYECEIKRLNKALQDALNIKCSFSEDC
LRKSRVEFCHEEMRTEMEVLKQQVQIYEEDFKKERSDRERLNQEKEELQQINETSQSQLN
RLNSQIKACQMEKEKLEKQLKQMYCPPCNCGLVFHLQDPWVPTGPGAVQKQREHPPDYQW
YALDQLPPDVQHKANGLSSVKKVHP
Sequence length 325
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Ovarian tumor domain proteases
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (2)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
MULTIPLE SCLEROSIS — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
PSORIASIS — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (2)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Colitis Ulcerative Associate 32190668
★★★★★
★☆☆☆☆
Found in Text Mining only
Inflammation Inhibit 23335080
★★★★★
★☆☆☆☆
Found in Text Mining only