Gene Gene information from NCBI Gene database.
Entrez ID 79923
Gene name Nanog homeobox
Gene symbol NANOG
Synonyms (NCBI Gene)
-
Chromosome 12
Chromosome location 12p13.31
Summary The protein encoded by this gene is a DNA binding homeobox transcription factor involved in embryonic stem (ES) cell proliferation, renewal, and pluripotency. The encoded protein can block ES cell differentiation and can also autorepress its own expressio
miRNA miRNA information provided by mirtarbase database.
211
miRTarBase ID miRNA Experiments Reference
MIRT006222 hsa-miR-34a-5p Luciferase reporter assayWestern blot 22020437
MIRT006222 hsa-miR-34a-5p Luciferase reporter assayWestern blot 22020437
MIRT006228 hsa-miR-34c-5p Luciferase reporter assayWestern blot 22020437
MIRT006229 hsa-miR-34b-3p Luciferase reporter assayWestern blot 22020437
MIRT006222 hsa-miR-34a-5p Luciferase reporter assayWestern blot 22020437
Transcription factors Transcription factors information provided by TRRUST V2 database.
8
Transcription factor Regulation Reference
CTCF Unknown 22879976
KDM2A Unknown 23872478
KLF4 Activation 19522013
MBD2 Repression 23255147
PBX1 Activation 19522013
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
37
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription cis-regulatory region binding IDA 25825768
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 23708658
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607937 20857 ENSG00000111704
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9H9S0
Protein name Homeobox protein NANOG (Homeobox transcription factor Nanog) (hNanog)
Protein function Transcription regulator involved in inner cell mass and embryonic stem (ES) cells proliferation and self-renewal. Imposes pluripotency on ES cells and prevents their differentiation towards extraembryonic endoderm and trophectoderm lineages. Blo
PDB 2KT0 , 4RBO
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 96 152 Homeodomain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in testicular carcinoma and derived germ cell tumors (at protein level). Expressed in fetal gonads, ovary and testis. Also expressed in ovary teratocarcinoma cell line and testicular embryonic carcinoma. Not expressed in many
Sequence
MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDL
LIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYL
SLQQMQELSNILNLSYKQVKTWFQNQRMKSKR
WQKNNWPKNSNGVTQKASAPTYPSLYSS
YHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPF
YNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNM
QPEDV
Sequence length 305
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Signaling pathways regulating pluripotency of stem cells
Proteoglycans in cancer
  POU5F1 (OCT4), SOX2, NANOG repress genes related to differentiation
POU5F1 (OCT4), SOX2, NANOG activate genes related to proliferation
Transcriptional regulation of pluripotent stem cells
Interleukin-4 and Interleukin-13 signaling