Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	79923
Gene name Gene Name - the full gene name approved by the HGNC.	Nanog homeobox
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NANOG
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12p13.31
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a DNA binding homeobox transcription factor involved in embryonic stem (ES) cell proliferation, renewal, and pluripotency. The encoded protein can block ES cell differentiation and can also autorepress its own expressio

Show/Hide all(211)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006222	hsa-miR-34a-5p	Luciferase reporter assay, Western blot	22020437
MIRT006222	hsa-miR-34a-5p	Luciferase reporter assay, Western blot	22020437
MIRT006228	hsa-miR-34c-5p	Luciferase reporter assay, Western blot	22020437
MIRT006229	hsa-miR-34b-3p	Luciferase reporter assay, Western blot	22020437
MIRT006222	hsa-miR-34a-5p	Luciferase reporter assay, Western blot	22020437
MIRT006222	hsa-miR-34a-5p	Luciferase reporter assay, Western blot	22020437
MIRT006228	hsa-miR-34c-5p	Luciferase reporter assay, Western blot	22020437
MIRT006229	hsa-miR-34b-3p	Luciferase reporter assay, Western blot	22020437
MIRT006222	hsa-miR-34a-5p	Luciferase reporter assay, Western blot	22020437
MIRT006222	hsa-miR-34a-5p	Luciferase reporter assay, Western blot	22020437
MIRT006228	hsa-miR-34c-5p	Luciferase reporter assay, Western blot	22020437
MIRT006229	hsa-miR-34b-3p	Luciferase reporter assay, Western blot	22020437
MIRT007216	hsa-miR-181a-3p	Luciferase reporter assay	23344176
MIRT007216	hsa-miR-181a-3p	Luciferase reporter assay	23344176
MIRT017305	hsa-miR-335-5p	Microarray	18185580
MIRT035522	hsa-miR-145-5p	Luciferase reporter assay	23541921
MIRT044412	hsa-miR-320a	CLASH	23622248
MIRT053286	hsa-miR-134-5p	Immunohistochemistry, qRT-PCR, Western blot	23467648
MIRT054183	hsa-miR-128-3p	Flow, qRT-PCR, Western blot	23019226
MIRT437511	hsa-miR-302a-3p	Luciferase reporter assay, qRT-PCR, Western blot	23255147
MIRT054183	hsa-miR-128-3p	Luciferase reporter assay	24903149
MIRT054183	hsa-miR-128-3p	Luciferase reporter assay	24903149
MIRT735720	hsa-miR-1252-5p	Luciferase reporter assay, Western blotting, qRT-PCR	33975615
MIRT1173304	hsa-miR-1258	CLIP-seq
MIRT1173305	hsa-miR-1321	CLIP-seq
MIRT1173306	hsa-miR-1827	CLIP-seq
MIRT1173307	hsa-miR-1908	CLIP-seq
MIRT1173308	hsa-miR-2114	CLIP-seq
MIRT1173309	hsa-miR-3125	CLIP-seq
MIRT1173310	hsa-miR-3145-5p	CLIP-seq
MIRT1173311	hsa-miR-3162-5p	CLIP-seq
MIRT1173312	hsa-miR-3165	CLIP-seq
MIRT1173313	hsa-miR-3175	CLIP-seq
MIRT1173314	hsa-miR-3656	CLIP-seq
MIRT1173315	hsa-miR-3689a-3p	CLIP-seq
MIRT1173316	hsa-miR-3689c	CLIP-seq
MIRT1173317	hsa-miR-3916	CLIP-seq
MIRT1173318	hsa-miR-3929	CLIP-seq
MIRT1173319	hsa-miR-423-3p	CLIP-seq
MIRT1173320	hsa-miR-4278	CLIP-seq
MIRT1173321	hsa-miR-4419b	CLIP-seq
MIRT1173322	hsa-miR-4433	CLIP-seq
MIRT1173323	hsa-miR-4476	CLIP-seq
MIRT1173324	hsa-miR-4478	CLIP-seq
MIRT1173325	hsa-miR-4533	CLIP-seq
MIRT1173326	hsa-miR-4649-3p	CLIP-seq
MIRT1173327	hsa-miR-4722-5p	CLIP-seq
MIRT1173328	hsa-miR-4728-5p	CLIP-seq
MIRT1173329	hsa-miR-4739	CLIP-seq
MIRT1173330	hsa-miR-4756-5p	CLIP-seq
MIRT1173331	hsa-miR-4767	CLIP-seq
MIRT1173332	hsa-miR-4779	CLIP-seq
MIRT1173333	hsa-miR-485-5p	CLIP-seq
MIRT1173334	hsa-miR-508-5p	CLIP-seq
MIRT1173335	hsa-miR-513b	CLIP-seq
MIRT1173336	hsa-miR-548p	CLIP-seq
MIRT1173337	hsa-miR-566	CLIP-seq
MIRT1173338	hsa-miR-624	CLIP-seq
MIRT1173339	hsa-miR-663	CLIP-seq
MIRT1173340	hsa-miR-765	CLIP-seq
MIRT1173341	hsa-miR-940	CLIP-seq
MIRT2050227	hsa-miR-1273	CLIP-seq
MIRT1173307	hsa-miR-1908	CLIP-seq
MIRT1173308	hsa-miR-2114	CLIP-seq
MIRT1173310	hsa-miR-3145-5p	CLIP-seq
MIRT1173318	hsa-miR-3929	CLIP-seq
MIRT1173319	hsa-miR-423-3p	CLIP-seq
MIRT2050228	hsa-miR-4252	CLIP-seq
MIRT1173321	hsa-miR-4419b	CLIP-seq
MIRT1173324	hsa-miR-4478	CLIP-seq
MIRT2050229	hsa-miR-4486	CLIP-seq
MIRT2050230	hsa-miR-4649-5p	CLIP-seq
MIRT1173331	hsa-miR-4767	CLIP-seq
MIRT2050231	hsa-miR-4793-3p	CLIP-seq
MIRT1173333	hsa-miR-485-5p	CLIP-seq
MIRT1173334	hsa-miR-508-5p	CLIP-seq
MIRT1173337	hsa-miR-566	CLIP-seq
MIRT2050232	hsa-miR-661	CLIP-seq
MIRT1173339	hsa-miR-663	CLIP-seq
MIRT2050233	hsa-miR-766	CLIP-seq
MIRT2279128	hsa-miR-1207-5p	CLIP-seq
MIRT2050227	hsa-miR-1273	CLIP-seq
MIRT2279129	hsa-miR-128	CLIP-seq
MIRT1173306	hsa-miR-1827	CLIP-seq
MIRT1173308	hsa-miR-2114	CLIP-seq
MIRT2279130	hsa-miR-24	CLIP-seq
MIRT2279131	hsa-miR-2682	CLIP-seq
MIRT1173310	hsa-miR-3145-5p	CLIP-seq
MIRT1173312	hsa-miR-3165	CLIP-seq
MIRT2279132	hsa-miR-3178	CLIP-seq
MIRT1173314	hsa-miR-3656	CLIP-seq
MIRT1173318	hsa-miR-3929	CLIP-seq
MIRT1173319	hsa-miR-423-3p	CLIP-seq
MIRT2050228	hsa-miR-4252	CLIP-seq
MIRT2279133	hsa-miR-4284	CLIP-seq
MIRT2279134	hsa-miR-4327	CLIP-seq
MIRT1173321	hsa-miR-4419b	CLIP-seq
MIRT1173322	hsa-miR-4433	CLIP-seq
MIRT1173324	hsa-miR-4478	CLIP-seq
MIRT2050229	hsa-miR-4486	CLIP-seq
MIRT2279135	hsa-miR-449c	CLIP-seq
MIRT2279136	hsa-miR-451b	CLIP-seq
MIRT1173326	hsa-miR-4649-3p	CLIP-seq
MIRT2050230	hsa-miR-4649-5p	CLIP-seq
MIRT1173327	hsa-miR-4722-5p	CLIP-seq
MIRT2279137	hsa-miR-4763-3p	CLIP-seq
MIRT1173331	hsa-miR-4767	CLIP-seq
MIRT2050231	hsa-miR-4793-3p	CLIP-seq
MIRT1173333	hsa-miR-485-5p	CLIP-seq
MIRT1173334	hsa-miR-508-5p	CLIP-seq
MIRT1173335	hsa-miR-513b	CLIP-seq
MIRT1173337	hsa-miR-566	CLIP-seq
MIRT1173338	hsa-miR-624	CLIP-seq
MIRT2279138	hsa-miR-645	CLIP-seq
MIRT2050232	hsa-miR-661	CLIP-seq
MIRT2050233	hsa-miR-766	CLIP-seq
MIRT1173341	hsa-miR-940	CLIP-seq
MIRT2050227	hsa-miR-1273	CLIP-seq
MIRT2391330	hsa-miR-1468	CLIP-seq
MIRT1173306	hsa-miR-1827	CLIP-seq
MIRT1173308	hsa-miR-2114	CLIP-seq
MIRT1173310	hsa-miR-3145-5p	CLIP-seq
MIRT1173318	hsa-miR-3929	CLIP-seq
MIRT1173319	hsa-miR-423-3p	CLIP-seq
MIRT2050228	hsa-miR-4252	CLIP-seq
MIRT1173321	hsa-miR-4419b	CLIP-seq
MIRT2391331	hsa-miR-4432	CLIP-seq
MIRT1173322	hsa-miR-4433	CLIP-seq
MIRT1173324	hsa-miR-4478	CLIP-seq
MIRT2050229	hsa-miR-4486	CLIP-seq
MIRT2279136	hsa-miR-451b	CLIP-seq
MIRT1173326	hsa-miR-4649-3p	CLIP-seq
MIRT2050230	hsa-miR-4649-5p	CLIP-seq
MIRT2391332	hsa-miR-4696	CLIP-seq
MIRT2050231	hsa-miR-4793-3p	CLIP-seq
MIRT1173333	hsa-miR-485-5p	CLIP-seq
MIRT1173334	hsa-miR-508-5p	CLIP-seq
MIRT1173335	hsa-miR-513b	CLIP-seq
MIRT1173337	hsa-miR-566	CLIP-seq
MIRT1173338	hsa-miR-624	CLIP-seq
MIRT2050232	hsa-miR-661	CLIP-seq
MIRT2050233	hsa-miR-766	CLIP-seq
MIRT1173341	hsa-miR-940	CLIP-seq
MIRT1173307	hsa-miR-1908	CLIP-seq
MIRT1173308	hsa-miR-2114	CLIP-seq
MIRT1173318	hsa-miR-3929	CLIP-seq
MIRT1173319	hsa-miR-423-3p	CLIP-seq
MIRT1173321	hsa-miR-4419b	CLIP-seq
MIRT1173324	hsa-miR-4478	CLIP-seq
MIRT1173331	hsa-miR-4767	CLIP-seq
MIRT1173333	hsa-miR-485-5p	CLIP-seq
MIRT1173337	hsa-miR-566	CLIP-seq
MIRT1173339	hsa-miR-663	CLIP-seq
MIRT2050227	hsa-miR-1273	CLIP-seq
MIRT2279129	hsa-miR-128	CLIP-seq
MIRT2391330	hsa-miR-1468	CLIP-seq
MIRT1173306	hsa-miR-1827	CLIP-seq
MIRT1173307	hsa-miR-1908	CLIP-seq
MIRT1173308	hsa-miR-2114	CLIP-seq
MIRT2577310	hsa-miR-3613-3p	CLIP-seq
MIRT1173318	hsa-miR-3929	CLIP-seq
MIRT1173319	hsa-miR-423-3p	CLIP-seq
MIRT1173321	hsa-miR-4419b	CLIP-seq
MIRT2391331	hsa-miR-4432	CLIP-seq
MIRT1173324	hsa-miR-4478	CLIP-seq
MIRT2050229	hsa-miR-4486	CLIP-seq
MIRT2279136	hsa-miR-451b	CLIP-seq
MIRT1173326	hsa-miR-4649-3p	CLIP-seq
MIRT2050230	hsa-miR-4649-5p	CLIP-seq
MIRT2577311	hsa-miR-4684-5p	CLIP-seq
MIRT2391332	hsa-miR-4696	CLIP-seq
MIRT1173331	hsa-miR-4767	CLIP-seq
MIRT1173333	hsa-miR-485-5p	CLIP-seq
MIRT2577312	hsa-miR-548c-3p	CLIP-seq
MIRT1173337	hsa-miR-566	CLIP-seq
MIRT2577313	hsa-miR-607	CLIP-seq
MIRT2050232	hsa-miR-661	CLIP-seq
MIRT1173339	hsa-miR-663	CLIP-seq
MIRT2050233	hsa-miR-766	CLIP-seq
MIRT1173341	hsa-miR-940	CLIP-seq
MIRT2050227	hsa-miR-1273	CLIP-seq
MIRT2279129	hsa-miR-128	CLIP-seq
MIRT2391330	hsa-miR-1468	CLIP-seq
MIRT1173306	hsa-miR-1827	CLIP-seq
MIRT1173307	hsa-miR-1908	CLIP-seq
MIRT1173308	hsa-miR-2114	CLIP-seq
MIRT2577310	hsa-miR-3613-3p	CLIP-seq
MIRT1173318	hsa-miR-3929	CLIP-seq
MIRT1173319	hsa-miR-423-3p	CLIP-seq
MIRT2050228	hsa-miR-4252	CLIP-seq
MIRT1173321	hsa-miR-4419b	CLIP-seq
MIRT2391331	hsa-miR-4432	CLIP-seq
MIRT1173324	hsa-miR-4478	CLIP-seq
MIRT2050229	hsa-miR-4486	CLIP-seq
MIRT2279136	hsa-miR-451b	CLIP-seq
MIRT1173326	hsa-miR-4649-3p	CLIP-seq
MIRT2050230	hsa-miR-4649-5p	CLIP-seq
MIRT2577311	hsa-miR-4684-5p	CLIP-seq
MIRT2391332	hsa-miR-4696	CLIP-seq
MIRT1173327	hsa-miR-4722-5p	CLIP-seq
MIRT1173331	hsa-miR-4767	CLIP-seq
MIRT2050231	hsa-miR-4793-3p	CLIP-seq
MIRT1173333	hsa-miR-485-5p	CLIP-seq
MIRT1173334	hsa-miR-508-5p	CLIP-seq
MIRT2577312	hsa-miR-548c-3p	CLIP-seq
MIRT1173337	hsa-miR-566	CLIP-seq
MIRT2577313	hsa-miR-607	CLIP-seq
MIRT2050232	hsa-miR-661	CLIP-seq
MIRT1173339	hsa-miR-663	CLIP-seq
MIRT2050233	hsa-miR-766	CLIP-seq
MIRT1173341	hsa-miR-940	CLIP-seq

Transcription factors

Show/Hide all(8)

Transcription factor	Regulation	Reference
CTCF	Unknown	22879976
KDM2A	Unknown	23872478
KLF4	Activation	19522013
MBD2	Repression	23255147
PBX1	Activation	19522013
POU5F1	Activation	17068183
POU5F1	Unknown	18338330
STAT3	Activation	21689689

Show/Hide all(31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription regulatory region sequence-specific DNA binding	IDA	25825768
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	23708658
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	ISS
GO:0001714	Process	Endodermal cell fate specification	IDA	20713518
GO:0003677	Function	DNA binding	IDA	16153702, 19427902
GO:0003700	Function	DNA-binding transcription factor activity	IDA	16153702
GO:0005515	Function	Protein binding	IPI	26687479
GO:0005634	Component	Nucleus	IC	16153702
GO:0005634	Component	Nucleus	IDA	18932205
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA	20458727
GO:0006355	Process	Regulation of transcription, DNA-templated	IDA	16153702
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0010468	Process	Regulation of gene expression	IMP	18388306
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019827	Process	Stem cell population maintenance	IEP	15108323
GO:0019827	Process	Stem cell population maintenance	ISS
GO:0030154	Process	Cell differentiation	IEP	16501172
GO:0035019	Process	Somatic stem cell population maintenance	IMP	18388306
GO:0035019	Process	Somatic stem cell population maintenance	TAS
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA
GO:0045595	Process	Regulation of cell differentiation	IMP	16501172
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	20713518
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000648	Process	Positive regulation of stem cell proliferation	IMP	16501172

MIM	HGNC	e!Ensembl
607937	20857	ENSG00000111704

Protein

UniProt ID

Q9H9S0

Protein name

Homeobox protein NANOG (Homeobox transcription factor Nanog) (hNanog)

Protein function

Transcription regulator involved in inner cell mass and embryonic stem (ES) cells proliferation and self-renewal. Imposes pluripotency on ES cells and prevents their differentiation towards extraembryonic endoderm and trophectoderm lineages. Blo

PDB

2KT0 , 4RBO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00046	Homeodomain	96 → 152	Homeodomain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in testicular carcinoma and derived germ cell tumors (at protein level). Expressed in fetal gonads, ovary and testis. Also expressed in ovary teratocarcinoma cell line and testicular embryonic carcinoma. Not expressed in many

Sequence

MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDL
LIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYL
SLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSS
YHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPF
YNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNM
QPEDV

Sequence length

305

Interactions

View interactions

	KEGG		Reactome
	Signaling pathways regulating pluripotency of stem cells Proteoglycans in cancer		POU5F1 (OCT4), SOX2, NANOG repress genes related to differentiation POU5F1 (OCT4), SOX2, NANOG activate genes related to proliferation Transcriptional regulation of pluripotent stem cells Interleukin-4 and Interleukin-13 signaling

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Neoplasm	Neoplasms, Germ Cell and Embryonal, Neoplasms, Embryonal and Mixed	rs137854562, rs137854565, rs137854568, rs137854574, rs121434220, rs121909218, rs121909222, rs587776667, rs606231169, rs587776701, rs121913388, rs137852578, rs137852216, rs121912651, rs28934575 View all (247 more)	16168501

Show/Hide Text Mining Associations (127)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	27285762, 27540973, 37461005
Adenocarcinoma of Lung	Associate	27285762
Adjustment Disorders	Associate	35186145
Alzheimer Disease	Inhibit	32580970
Ameloblastoma	Associate	36655039
Bone Diseases	Associate	16331882
Breast Neoplasms	Associate	16228988, 19633292, 25127259, 25405855, 27001847, 27981531, 28422735, 30220190, 30845764, 30906504, 31853860, 32427827, 33233699, 34592152, 36142823, 37768037 View all (1 more)
Calcinosis Cutis	Associate	32169072
Carcinogenesis	Associate	18419830, 23708493, 35008480, 37461005, 39986058
Carcinoma Embryonal	Associate	16206293, 17314394, 19876845, 22963770, 25464862, 27803193, 35008480
Carcinoma Hepatocellular	Associate	24944491, 25502816, 25668819, 26919045, 26939902, 27050147, 27685621, 28566884, 30672133, 32033570, 35142429, 36147467
Carcinoma in Situ	Stimulate	16206293
Carcinoma Non Small Cell Lung	Associate	23451039, 23648139, 32930122
Carcinoma Ovarian Epithelial	Associate	25038052, 26801672, 27884977, 33313950, 36114703
Carcinoma Renal Cell	Stimulate	17360937
Carcinoma Renal Cell	Inhibit	21982273
Carcinoma Renal Cell	Associate	26631537, 30082842, 31420918
Carcinoma Small Cell	Associate	25144243, 34911496
Carcinoma Squamous Cell	Associate	20161759, 31322538, 35848482
Chondrosarcoma	Associate	29138803
Choriocarcinoma	Associate	18772339
Choriocarcinoma Non gestational	Associate	18755845
Clear cell metastatic renal cell carcinoma	Stimulate	27812180
Colonic Neoplasms	Associate	27540973, 32428045
Colorectal Neoplasms	Associate	20026903, 25003232, 27057280, 27207017, 28453235, 29053388, 29426374, 33901792, 35177584, 37083591, 38233377
Colorectal Neoplasms	Stimulate	28990068
Diabetes Insipidus Neurogenic	Associate	32927425
Diabetes Mellitus	Stimulate	23064289
Diabetes Mellitus Type 2	Associate	23306198, 37028179
Dissection Thoracic Aorta	Associate	28625769
Endodermal Sinus Tumor	Associate	27803193
Endometrial Neoplasms	Stimulate	24884521
Endometrial Neoplasms	Associate	35186145
Endometriosis	Associate	24884521
Esophageal Neoplasms	Associate	37461005
Esophageal Squamous Cell Carcinoma	Associate	25148045, 25220908, 34520294
Gallbladder Neoplasms	Associate	26318430
Germinoma	Associate	20178649
Gestational Trophoblastic Disease	Associate	18772339
Gestational Trophoblastic Disease	Stimulate	32584203
Glioblastoma	Associate	23467648, 25359730, 25787115, 26983719, 29787607, 29849920, 31151327, 32092088, 33049683, 36142158, 37372456
Glioma	Associate	23708493, 24552705
Glycogen Storage Disease IIIB	Associate	30408744
Head and Neck Neoplasms	Associate	32019273
Hematologic Diseases	Associate	26318430
Hepatitis B	Associate	26919045, 35022275
Hepatitis C	Associate	35022275
Hyperplasia	Associate	36170598
Hypoxia	Stimulate	21712410, 21911602, 22216200, 23272057, 27001847, 37768037
Hypoxia	Associate	32427827
Hypoxia Brain	Stimulate	21911602, 27902770
Hypoxia Brain	Associate	34592152
Infections	Stimulate	28794048
Inflammation	Stimulate	26919045
Kidney Neoplasms	Associate	30082842
Laryngeal Neoplasms	Associate	28894270
Laryngitis	Associate	28894270
Leigh Disease	Associate	31017045
Leukemia	Associate	20427424, 30262802
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	32780298
Leukemia Myeloid Acute	Associate	28245563, 28718379, 31825998
Liver Failure	Associate	35022275
Liver Neoplasms	Associate	29033320
Lung Neoplasms	Stimulate	23683495
Lung Neoplasms	Associate	28400280
Lymphatic Diseases	Stimulate	27285762
Lymphatic Metastasis	Stimulate	20026903, 32733958, 35186145
Lymphatic Metastasis	Associate	26631537, 30220190, 37774079
Lymphatic Metastasis	Inhibit	29113102
Lymphoma	Associate	27911272
Lymphoproliferative Disorders	Associate	17360937
Melanoma	Associate	18604175, 25953317, 39459448
Mesothelioma Malignant	Associate	23886156
Mouth Diseases	Stimulate	39459448
Mouth Neoplasms	Associate	27612478, 36170598
Multiple Myeloma	Associate	28008160, 36752202
Myelodysplastic Syndromes	Associate	31825998
Nasopharyngeal Carcinoma	Associate	23424657
Nasopharyngeal Neoplasms	Associate	34503528
Neoplasm Invasiveness	Stimulate	35186145
Neoplasm Metastasis	Associate	26483189, 28400280, 29787607, 30082842, 34503528, 36114703, 39459448
Neoplasm Metastasis	Stimulate	36946271
Neoplasms	Associate	16206293, 18419830, 18441325, 18443585, 19956629, 20026903, 21442631, 21911602, 22847005, 22989882, 23424657, 23708493, 23921511, 24199791, 24462277 View all (69 more)
Neoplasms	Inhibit	21982273, 29849920
Neoplasms	Stimulate	25024430, 27612478, 30595538, 33049683
Neoplasms Germ Cell and Embryonal	Associate	16206293, 20930529, 27905446
Nervous System Neoplasms	Associate	18419830
Neurilemmoma	Associate	33222917
Neuroblastoma	Associate	19458492, 29158813
Neuroblastoma	Stimulate	21909813
Noonan Syndrome	Associate	33140329
Osteosarcoma	Associate	19242128, 22870217
Ovarian Diseases	Associate	24884521
Ovarian Neoplasms	Associate	22927443, 26801672, 27884977, 29499737, 31735168, 32169072, 33313950, 36114703, 37774079
Pagetoid Reticulosis	Stimulate	39459448
Pancreatic Neoplasms	Associate	23272057, 29574322, 31147453, 34675409
Pancreatic Neoplasms	Stimulate	36232741
Personality Disorders	Associate	28422735
Precancerous Conditions	Associate	28894270
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	32146726
Prostatic Neoplasms	Associate	22252524, 23024790, 23936228, 25175748, 30595538, 34948357, 35908276
Prostatic stromal proliferation of uncertain malignant potential	Associate	36170598
Prostatitis	Associate	21712410
Pulmonary Disease Chronic Obstructive	Associate	32055858
Rectal Neoplasms	Associate	29214774, 29475734
Renal Insufficiency	Associate	33960101
Retinal Dysplasia	Associate	35186145
Retinoblastoma	Associate	27879208
Rhabdomyosarcoma	Stimulate	25329465, 33372065
Rhabdomyosarcoma Embryonal	Associate	26189795
Sarcoma	Associate	34321458
Seminoma	Associate	16206293, 16228988
Spheroid body myopathy	Stimulate	34948357
Squamous Cell Carcinoma of Head and Neck	Associate	21685938, 22847005, 24533098, 26483189, 26626427, 29113102, 31244283, 32733958, 32986350
Squamous Cell Carcinoma of Head and Neck	Stimulate	22384257, 25379016, 30143678
Stomach Neoplasms	Associate	23229446, 26940070, 29689047, 34060205
Teratoma	Associate	27803193
Testicular Germ Cell Tumor	Associate	17167184, 33224314
Thecoma	Associate	32584203
Triple Negative Breast Neoplasms	Associate	39271768
Tuberculosis Multidrug Resistant	Stimulate	18441325
Tuberous Sclerosis 1	Associate	22870217
Urethral Neoplasms	Associate	29279584
Urinary Bladder Neoplasms	Associate	28720065, 29279584
Uterine Cervical Neoplasms	Associate	18419830, 34697063
Uterine Cervical Neoplasms	Stimulate	30791957
X Inactivation Familial Skewed 1	Associate	33021557

NANOG (Nanog homeobox)