Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	79903
Gene name	N-alpha-acetyltransferase 60, NatF catalytic subunit
Gene symbol	NAA60
Synonyms (NCBI Gene)	HAT4IBGC9NAT15NatFhNaa60
Chromosome	16
Chromosome location	16p13.3
Summary	This gene encodes an enzyme that localizes to the Golgi apparatus, where it transfers an acetyl group to the N-terminus of free proteins. This enzyme acts on histones, and its activity is important for chromatin assembly and chromosome integrity. Alternat

Show/Hide all (1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT051437	hsa-let-7e-5p	CLASH	23622248

Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IBA
GO:0000139	Component	Golgi membrane	IDA	21981917, 25732826
GO:0000139	Component	Golgi membrane	IEA
GO:0004402	Function	Histone acetyltransferase activity	IBA
GO:0004402	Function	Histone acetyltransferase activity	IEA
GO:0004596	Function	Protein-N-terminal amino-acid acetyltransferase activity	IBA
GO:0004596	Function	Protein-N-terminal amino-acid acetyltransferase activity	IDA	21750686, 21981917, 25732826, 27320834, 27550639
GO:0004596	Function	Protein-N-terminal amino-acid acetyltransferase activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183, 32814053
GO:0005794	Component	Golgi apparatus	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006334	Process	Nucleosome assembly	IDA	21981917
GO:0006474	Process	N-terminal protein amino acid acetylation	IDA	25732826, 27320834, 27550639
GO:0007059	Process	Chromosome segregation	IBA
GO:0007059	Process	Chromosome segregation	IEA
GO:0007059	Process	Chromosome segregation	ISS
GO:0008283	Process	Cell population proliferation	IMP	21981917
GO:0010485	Function	Histone H4 acetyltransferase activity	IDA	21981917
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0016747	Function	Acyltransferase activity, transferring groups other than amino-acyl groups	IEA
GO:0017196	Process	N-terminal peptidyl-methionine acetylation	IDA	21750686
GO:0042803	Function	Protein homodimerization activity	IDA	27320834
GO:0061733	Function	Protein-lysine-acetyltransferase activity	IEA
GO:0120518	Function	Protein N-terminal-methionine acetyltransferase activity	IEA

MIM	HGNC	e!Ensembl
614246	25875	ENSG00000122390

Q9H7X0

Protein name

N-alpha-acetyltransferase 60 (hNaa60) (EC 2.3.1.259) (Histone acetyltransferase type B protein 4) (HAT4) (EC 2.3.1.48) (N-acetyltransferase 15) (N-alpha-acetyltransferase F) (NatF)

Protein function

N-alpha-acetyltransferase that specifically mediates the acetylation of N-terminal residues of the transmembrane proteins, with a strong preference for N-termini facing the cytosol (PubMed:25732826, PubMed:38480682). Displays N-terminal acetyltr

PDB

5HGZ , 5HH0 , 5HH1 , 5ICV , 5ICW

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00583	Acetyltransf_1	23 → 155	Acetyltransferase (GNAT) family	Family

Sequence

MTEVVPSSALSEVSLRLLCHDDIDTVKHLCGDWFPIEYPDSWYRDITSNKKFFSLAATYR
GAIVGMIVAEIKNRTKIHKEDGDILASNFSVDTQVAYILSLGVVKEFRKHGIGSLLLESL
KDHISTTAQDHCKAIYLHVLTTNNTAINFYENRDFKQHHYLPYYYSIRGVLKDGFTYVLY
INGGHPPWTILDYIQHLGSALASLSPCSIPHRVYRQAHSLLCSFLPWSGISSKSGIEYSR
TM

Sequence length

242

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Basal ganglia calcification, idiopathic, 9, autosomal recessive	Pathogenic	rs751041684, rs2543852689, rs530032228, rs748506439, rs756008307, rs767025617	RCV004372005 RCV004372006 RCV004372007 RCV004372008 RCV004372009 RCV004372010	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BILATERAL STRIOPALLIDODENTATE CALCINOSIS	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAHR'S DISEASE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC BASAL GANGLIA CALCIFICATION 1	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TUBERCULOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Carcinoma Non Small Cell Lung	Associate	33307925	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infections	Associate	35095845	★★★★★ ★☆☆☆☆ Found in Text Mining only
Influenza Human	Associate	35095845	★★★★★ ★☆☆☆☆ Found in Text Mining only

NAA60 (N-alpha-acetyltransferase 60, NatF catalytic subunit)