RPP21 (ribonuclease P subunit p21)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein Pathways
Entrez ID 79897
Gene name Ribonuclease P subunit p21
Gene symbol RPP21
Synonyms (NCBI Gene)
C6orf135CAT60
Chromosome 6
Chromosome location 6p22.1
Summary RPP21 is a protein subunit of nuclear ribonuclease P, which processes the 5-prime leader sequence of precursor tRNAs (Jarrous et al., 2001 [PubMed 11497433]).[supplied by OMIM, Jan 2009]
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18
Gene Gene ontology Other IDs Protein Pathways
Show/Hide all (18)
GO ID Ontology Definition Evidence Reference
GO:0001682 Process TRNA 5'-leader removal IDA 16723659, 30454648
GO:0003723 Function RNA binding IEA
GO:0004526 Function Ribonuclease P activity IDA 30454648
GO:0004526 Function Ribonuclease P activity IEA
GO:0005515 Function Protein binding IPI 15096576, 30454648, 33961781
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
612524 21300 ENSG00000241370
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein Pathways
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9H633
Protein name Ribonuclease P protein subunit p21 (RNaseP protein p21) (Ribonuclease P/MRP 21 kDa subunit) (Ribonucleoprotein V)
Protein function Component of ribonuclease P, a ribonucleoprotein complex that generates mature tRNA molecules by cleaving their 5'-ends.
PDB 6AHR , 6AHU
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04032 Rpr2 13 → 96 RNAse P Rpr2/Rpp21/SNM1 subunit domain Family
Sequence 
MAGPVKDREAFQRLNFLYQAAHCVLAQDPENQALARFYCYTERTIAKRLVLRRDPSVKRT
LCRGCSSLLVPGLTCTQRQRRCRGQRWTVQTCLTCQRSQRFLNDPGHLLWGDRPEAQLGS
QADSKPLQPLPNTAHSISDRLPEEKMQTQGSSNQ
Sequence length 154
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene Gene ontology Other IDs Protein Pathways
  Reactome
    tRNA processing in the nucleus
Major pathway of rRNA processing in the nucleolus and cytosol