RPP21 (ribonuclease P subunit p21)

Gene
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
79897
Gene name Gene Name - the full gene name approved by the HGNC.
Ribonuclease P subunit p21
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RPP21
Synonyms (NCBI Gene) Gene synonyms aliases
C6orf135, CAT60
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p22.1
Summary Summary of gene provided in NCBI Entrez Gene.
RPP21 is a protein subunit of nuclear ribonuclease P, which processes the 5-prime leader sequence of precursor tRNAs (Jarrous et al., 2001 [PubMed 11497433]).[supplied by OMIM, Jan 2009]
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(18)
GO ID Ontology Definition Evidence Reference
GO:0001682 Process TRNA 5'-leader removal IDA 16723659, 30454648
GO:0003723 Function RNA binding IEA
GO:0004526 Function Ribonuclease P activity IDA 30454648
GO:0004526 Function Ribonuclease P activity IEA
GO:0005515 Function Protein binding IPI 15096576, 30454648, 33961781
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
612524 21300 ENSG00000241370
Protein
Gene Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q9H633
Protein name Ribonuclease P protein subunit p21 (RNaseP protein p21) (Ribonuclease P/MRP 21 kDa subunit) (Ribonucleoprotein V)
Protein function Component of ribonuclease P, a ribonucleoprotein complex that generates mature tRNA molecules by cleaving their 5'-ends.
PDB 6AHR , 6AHU
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04032 Rpr2 13 → 96 RNAse P Rpr2/Rpp21/SNM1 subunit domain Family
Sequence 
MAGPVKDREAFQRLNFLYQAAHCVLAQDPENQALARFYCYTERTIAKRLVLRRDPSVKRT
LCRGCSSLLVPGLTCTQRQRRCRGQRWTVQTCLTCQRSQRFLNDPGHLLWGDRPEAQLGS
QADSKPLQPLPNTAHSISDRLPEEKMQTQGSSNQ
Sequence length 154
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    tRNA processing in the nucleus
Major pathway of rRNA processing in the nucleolus and cytosol
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (3)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Anxiety Disorder Anxiety N/A N/A GWAS
Insomnia Insomnia N/A N/A GWAS
Neuroticism Neuroticism N/A N/A GWAS
Show/Hide Text Mining Associations (2)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 35833210
Neoplasms Stimulate 35833210