Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	79891
Gene name	Zinc finger protein 671
Gene symbol	ZNF671
Synonyms (NCBI Gene)	-
Chromosome	19
Chromosome location	19q13.43

Show/Hide all (53)

miRTarBase ID	miRNA	Experiments
MIRT1534626	hsa-miR-1245b-5p	CLIP-seq
MIRT1534627	hsa-miR-186	CLIP-seq
MIRT1534628	hsa-miR-2681	CLIP-seq
MIRT1534629	hsa-miR-3133	CLIP-seq
MIRT1534630	hsa-miR-3142	CLIP-seq
MIRT1534631	hsa-miR-4650-5p	CLIP-seq
MIRT1534632	hsa-miR-4773	CLIP-seq
MIRT1534633	hsa-miR-4795-3p	CLIP-seq
MIRT2380508	hsa-miR-513a-5p	CLIP-seq
MIRT2672605	hsa-miR-1	CLIP-seq
MIRT2672606	hsa-miR-1470	CLIP-seq
MIRT2672607	hsa-miR-150	CLIP-seq
MIRT2672608	hsa-miR-1587	CLIP-seq
MIRT2672609	hsa-miR-206	CLIP-seq
MIRT2672610	hsa-miR-2355-5p	CLIP-seq
MIRT2672611	hsa-miR-3117-5p	CLIP-seq
MIRT2672612	hsa-miR-3147	CLIP-seq
MIRT2672613	hsa-miR-3160-3p	CLIP-seq
MIRT2672614	hsa-miR-4425	CLIP-seq
MIRT2672615	hsa-miR-4436b-5p	CLIP-seq
MIRT2672616	hsa-miR-4487	CLIP-seq
MIRT2672617	hsa-miR-4492	CLIP-seq
MIRT2672618	hsa-miR-4498	CLIP-seq
MIRT2672619	hsa-miR-4656	CLIP-seq
MIRT2672620	hsa-miR-4667-3p	CLIP-seq
MIRT2672621	hsa-miR-4670-3p	CLIP-seq
MIRT2672622	hsa-miR-4674	CLIP-seq
MIRT2672623	hsa-miR-4675	CLIP-seq
MIRT2672624	hsa-miR-4741	CLIP-seq
MIRT2672625	hsa-miR-4792	CLIP-seq
MIRT2380508	hsa-miR-513a-5p	CLIP-seq
MIRT2672626	hsa-miR-550b	CLIP-seq
MIRT2672627	hsa-miR-558	CLIP-seq
MIRT2672628	hsa-miR-604	CLIP-seq
MIRT2672629	hsa-miR-613	CLIP-seq
MIRT2672630	hsa-miR-642a	CLIP-seq
MIRT2672631	hsa-miR-647	CLIP-seq
MIRT2672632	hsa-miR-762	CLIP-seq
MIRT2672605	hsa-miR-1	CLIP-seq
MIRT2672606	hsa-miR-1470	CLIP-seq
MIRT2672607	hsa-miR-150	CLIP-seq
MIRT2672609	hsa-miR-206	CLIP-seq
MIRT2672610	hsa-miR-2355-5p	CLIP-seq
MIRT2672611	hsa-miR-3117-5p	CLIP-seq
MIRT2672615	hsa-miR-4436b-5p	CLIP-seq
MIRT2672620	hsa-miR-4667-3p	CLIP-seq
MIRT2672621	hsa-miR-4670-3p	CLIP-seq
MIRT2380508	hsa-miR-513a-5p	CLIP-seq
MIRT2672626	hsa-miR-550b	CLIP-seq
MIRT2672628	hsa-miR-604	CLIP-seq
MIRT2672629	hsa-miR-613	CLIP-seq
MIRT2672630	hsa-miR-642a	CLIP-seq
MIRT2672631	hsa-miR-647	CLIP-seq

Show/Hide all (9)

GO ID	Ontology	Definition	Evidence
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q8TAW3

Protein name

Zinc finger protein 671

Protein function

May be involved in transcriptional regulation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01352	KRAB	48 → 89	KRAB box	Family
PF00096	zf-C2H2	285 → 307	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	313 → 335	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	341 → 363	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	369 → 391	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	397 → 419	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	425 → 447	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	479 → 501	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	507 → 529	Zinc finger, C2H2 type	Domain

Sequence

MLSPVSRDASDALQGRKCLRPRSRRLPLPAAVRAHGPMAELTDSARGCVVFEDVFVYFSR
EEWELLDDAQRLLYHDVMLENFALLASLGIAFSRSRAVMKLERGEEPWVYDQVDMTSATE
REAQRGLRPGCWHGVEDEEVSSEQSIFVAGVSEVRTLMAELESHPCDICGPILKDTLHLA
KYHGGKARQKPYLCGACGKQFWFSTDFDQHQNQPNGGKLFPRKEGRDSVKSCRVHVPEKT
LTCGKGRRDFSATSGLLQHQASLSSMKPHKSTKLVSGFLMGQRYHRCGECGKAFTRKDTL
ARHQRIHTGERPYECNECGKFFSQSYDLFKHQTVHTGERPYECSECGKFFRQISGLIEHR
RVHTGERLYQCGKCGKFFSSKSNLIRHQEVHTGARPYVCSECGKEFSRKHTLVLHQRTHT
GERPYECSECGKAFSQSSHLNVHWRIHSSDYECSRCGKAFSCISKLIQHQKVHSGEKPYE
CSKCGKAFTQRPNLIRHWKVHTGERPYVCSECGREFIRKQTLVLHQRVHAGEKL

Sequence length

534

Interactions

View interactions

	Reactome
			Generic Transcription Pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
SEASONAL ALLERGIC RHINITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Carcinoma Renal Cell	Associate	22610075, 25332168	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Associate	31527170	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Associate	37215982	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Associate	40707893	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Associate	28716111, 32324312	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	30633424, 36803573, 37215982	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	30633424	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precancerous Conditions	Associate	36803573	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Inhibit	37215982	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Associate	37557178, 40707893	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Associate	24647315, 36803573, 37557178, 40707893	★★★★★ ★☆☆☆☆ Found in Text Mining only

ZNF671 (zinc finger protein 671)