Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	79890
Gene name Gene Name - the full gene name approved by the HGNC.	Ras and Rab interactor 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RIN3
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	14q32.12
Summary Summary of gene provided in NCBI Entrez Gene.	Summary: This protein encoded by this gene is a member of the RIN family of Ras interaction-interference proteins, which are binding partners to the RAB5 small GTPases. The protein functions as a guanine nucleotide exchange for RAB5B and RAB31. Alternativ

Show/Hide all(53)

miRTarBase ID	miRNA	Experiments	Reference
MIRT491628	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT491626	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT491625	hsa-miR-1914-3p	PAR-CLIP	23592263
MIRT491624	hsa-miR-5194	PAR-CLIP	23592263
MIRT491623	hsa-miR-6738-5p	PAR-CLIP	23592263
MIRT491622	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT491621	hsa-miR-4710	PAR-CLIP	23592263
MIRT491620	hsa-miR-6734-5p	PAR-CLIP	23592263
MIRT491628	hsa-miR-3184-5p	PAR-CLIP	23592263
MIRT491626	hsa-miR-423-5p	PAR-CLIP	23592263
MIRT491625	hsa-miR-1914-3p	PAR-CLIP	23592263
MIRT491624	hsa-miR-5194	PAR-CLIP	23592263
MIRT491623	hsa-miR-6738-5p	PAR-CLIP	23592263
MIRT491622	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT491621	hsa-miR-4710	PAR-CLIP	23592263
MIRT491620	hsa-miR-6734-5p	PAR-CLIP	23592263
MIRT1307300	hsa-miR-2110	CLIP-seq
MIRT1307301	hsa-miR-22	CLIP-seq
MIRT1307302	hsa-miR-28-5p	CLIP-seq
MIRT1307303	hsa-miR-3139	CLIP-seq
MIRT1307304	hsa-miR-3150b-3p	CLIP-seq
MIRT1307305	hsa-miR-3184	CLIP-seq
MIRT1307306	hsa-miR-3197	CLIP-seq
MIRT1307307	hsa-miR-4271	CLIP-seq
MIRT1307308	hsa-miR-4300	CLIP-seq
MIRT1307309	hsa-miR-4488	CLIP-seq
MIRT1307310	hsa-miR-4633-3p	CLIP-seq
MIRT1307311	hsa-miR-4667-5p	CLIP-seq
MIRT1307312	hsa-miR-4689	CLIP-seq
MIRT1307313	hsa-miR-4697-5p	CLIP-seq
MIRT1307314	hsa-miR-4700-5p	CLIP-seq
MIRT1307315	hsa-miR-4706	CLIP-seq
MIRT1307316	hsa-miR-4725-3p	CLIP-seq
MIRT1307317	hsa-miR-4734	CLIP-seq
MIRT1307318	hsa-miR-4749-5p	CLIP-seq
MIRT1307319	hsa-miR-4784	CLIP-seq
MIRT1307320	hsa-miR-544b	CLIP-seq
MIRT1307321	hsa-miR-558	CLIP-seq
MIRT1307322	hsa-miR-610	CLIP-seq
MIRT1307323	hsa-miR-637	CLIP-seq
MIRT1307324	hsa-miR-661	CLIP-seq
MIRT1307325	hsa-miR-708	CLIP-seq
MIRT1307326	hsa-miR-744	CLIP-seq
MIRT1307327	hsa-miR-920	CLIP-seq
MIRT2091089	hsa-miR-2278	CLIP-seq
MIRT2091090	hsa-miR-3155	CLIP-seq
MIRT2091091	hsa-miR-3155b	CLIP-seq
MIRT2091092	hsa-miR-4299	CLIP-seq
MIRT2091093	hsa-miR-4456	CLIP-seq
MIRT2091094	hsa-miR-4690-5p	CLIP-seq
MIRT2091095	hsa-miR-484	CLIP-seq
MIRT2091096	hsa-miR-548q	CLIP-seq
MIRT2091097	hsa-miR-760	CLIP-seq

Show/Hide all(20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002091	Process	Negative regulation of receptor internalization	IMP	23185384
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IMP	21586568, 23185384
GO:0005096	Function	GTPase activator activity	IEA
GO:0005515	Function	Protein binding	IPI	17474147, 23185384, 25814554
GO:0005737	Component	Cytoplasm	IDA	18486601
GO:0005769	Component	Early endosome	IDA	21586568
GO:0005829	Component	Cytosol	TAS
GO:0006897	Process	Endocytosis	NAS	11733506
GO:0007165	Process	Signal transduction	IEA
GO:0030139	Component	Endocytic vesicle	IDA	18486601
GO:0030424	Component	Axon	ISS	32552912
GO:0030425	Component	Dendrite	ISS	32552912
GO:0031267	Function	Small GTPase binding	IDA	21586568
GO:0031267	Function	Small GTPase binding	TAS	18486601
GO:0031410	Component	Cytoplasmic vesicle	IDA	21586568
GO:0031982	Component	Vesicle	IDA	32552912
GO:0043025	Component	Neuronal cell body	ISS	32552912
GO:0043547	Process	Positive regulation of GTPase activity	IEA
GO:0060755	Process	Negative regulation of mast cell chemotaxis	IMP	23185384
GO:0097494	Process	Regulation of vesicle size	IDA	32552912

MIM	HGNC	e!Ensembl
610223	18751	ENSG00000100599

Protein

UniProt ID

Q8TB24

Protein name

Ras and Rab interactor 3 (Ras interaction/interference protein 3)

Protein function

Ras effector protein that functions as a guanine nucleotide exchange (GEF) for RAB5B and RAB31, by exchanging bound GDP for free GTP. Required for normal RAB31 function.

PDB

3U23 , 4WCI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02204	VPS9	739 → 842	Vacuolar sorting protein 9 (VPS9) domain	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:12972505}.

Sequence

MIRHAGAPARGDPTGPVPVVGKGEEEEEEDGMRLCLPANPKNCLPHRRGISILEKLIKTC
PVWLQLSLGQAEVARILHRVVAGMFLVRRDSSSKQLVLCVHFPSLNESSAEVLEYTIKEE
KSILYLEGSALVFEDIFRLIAFYCVSRDLLPFTLRLPQAILEASSFTDLETIANLGLGFW
DSSLNPPQERGKPAEPPRDRAPGFPLVSSLRPTAHDANCACEIELSVGNDRLWFVNPIFI
EDCSSALPTDQPPLGNCPARPLPPTSDATSPTSRWAPRRPPPPPPVLPLQPCSPAQPPVL
PALAPAPACPLPTSPPVPAPHVTPHAPGPPDHPNQPPMMTCERLPCPTAGLGPLREEAMK
PGAASSPLQQVPAPPLPAKKNLPTAPPRRRVSERVSLEDQSPGMAAEGDQLSLPPQGTSD
GPEDTPRESTEQGQDTEVKASDPHSMPELPRTAKQPPVPPPRKKRISRQLASTLPAPLEN
AELCTQAMALETPTPGPPREGQSPASQAGTQHPPAQATAHSQSSPEFKGSLASLSDSLGV
SVMATDQDSYSTSSTEEELEQFSSPSVKKKPSMILGKARHRLSFASFSSMFHAFLSNNRK
LYKKVVELAQDKGSYFGSLVQDYKVYSLEMMARQTSSTEMLQEIRTMMTQLKSYLLQSTE
LKALVDPALHSEEELEAIVESALYKCVLKPLKEAINSCLHQIHSKDGSLQQLKENQLVIL
ATTTTDLGVTTSVPEVPMMEKILQKFTSMHKAYSPEKKISILLKTCKLIYDSMALGNPGK
PYGADDFLPVLMYVLARSNLTEMLLNVEYMMELMDPALQLGEGSYYLTTTYGALEHIKSY
DKITVTRQLSVEVQDSIHRWERRRTLNKARASRSSVQDFICVSYLEPEQQARTLASRADT
QAQALCAQCAEKFAVERPQAHRLFVLVDGRCFQLADDALPHCIKGYLLRSEPKRDFHFVY
RPLDGGGGGGGGSPPCLVVREPNFL

Sequence length

985

Interactions

View interactions

	Reactome
			RAB GEFs exchange GTP for GDP on RABs

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Paget disease	Osteitis Deformans	rs796051862, rs796051869, rs796051870, rs796052213, rs1555767678, rs869025582	21623375

Show/Hide Unknown Diseases (8)

Disease term	Disease name	Evidence	Source
Unknown
Eczema	Eczema		GWAS
Breast cancer	Breast cancer	Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients	GWAS, CBGDA
Colorectal Cancer	Colorectal Cancer	In summary, our data strongly demonstrated that upregulation of GRB7 conferred MEKi resistance in CRC cells with KRAS mutations by mediating RTK signaling through the recruitment of PLK1.	GWAS, CBGDA
Biliary Cholangitis	Biliary Cholangitis		GWAS
Alzheimer disease	Alzheimer disease		GWAS
Asthma	Asthma		GWAS
Rheumatoid arthritis	Rheumatoid arthritis		GWAS
Endometriosis	Endometriosis		GWAS

Show/Hide Text Mining Associations (17)

Disease Name	Relationship Type	References
Associations from Text Mining
Alzheimer Disease	Associate	28199971, 30258121, 30830563, 33419465, 33794991, 35090342, 35241726, 36411364, 37322917
Amyloidosis	Associate	33419465
Anemia Sickle Cell	Associate	17156400
Cognition Disorders	Associate	28199971, 37322917
Cognitive Dysfunction	Associate	37322917
Dementia	Associate	30830563
Dementia Vascular	Associate	30830563
Fractures Spontaneous	Associate	33419465
Hyperostosis corticalis deformans juvenilis	Associate	24945404
Lung Diseases	Associate	26635082
Mastocytosis	Associate	23185384
Neoplasms	Associate	23185384
Obesity	Associate	28445147
Osteitis Deformans	Associate	21623375
Pulmonary Disease Chronic Obstructive	Associate	25171373, 37422806
Stroke	Associate	30830563
Tauopathies	Associate	33419465

RIN3 (Ras and Rab interactor 3)