Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	79870
Gene name Gene Name - the full gene name approved by the HGNC.	BAALC binder of MAP3K1 and KLF4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	BAALC
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8q22.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene was identified by gene expression studies in patients with acute myeloid leukemia (AML). The gene is conserved among mammals and is not found in lower organisms. Tissues that express this gene develop from the neuroectoderm. Multiple alternative

Show/Hide all(100)

miRTarBase ID	miRNA	Experiments
MIRT814085	hsa-miR-1197	CLIP-seq
MIRT814086	hsa-miR-1252	CLIP-seq
MIRT814087	hsa-miR-1825	CLIP-seq
MIRT814088	hsa-miR-1976	CLIP-seq
MIRT814089	hsa-miR-199a-5p	CLIP-seq
MIRT814090	hsa-miR-199b-5p	CLIP-seq
MIRT814091	hsa-miR-2467-3p	CLIP-seq
MIRT814092	hsa-miR-3065-5p	CLIP-seq
MIRT814093	hsa-miR-3163	CLIP-seq
MIRT814094	hsa-miR-365	CLIP-seq
MIRT814095	hsa-miR-3678-3p	CLIP-seq
MIRT814096	hsa-miR-370	CLIP-seq
MIRT814097	hsa-miR-371-3p	CLIP-seq
MIRT814098	hsa-miR-4269	CLIP-seq
MIRT814099	hsa-miR-4283	CLIP-seq
MIRT814100	hsa-miR-4427	CLIP-seq
MIRT814101	hsa-miR-4488	CLIP-seq
MIRT814102	hsa-miR-4514	CLIP-seq
MIRT814103	hsa-miR-4663	CLIP-seq
MIRT814104	hsa-miR-4692	CLIP-seq
MIRT814105	hsa-miR-4697-5p	CLIP-seq
MIRT814106	hsa-miR-4742-5p	CLIP-seq
MIRT814107	hsa-miR-548n	CLIP-seq
MIRT814108	hsa-miR-548t	CLIP-seq
MIRT814109	hsa-miR-561	CLIP-seq
MIRT814110	hsa-miR-587	CLIP-seq
MIRT814111	hsa-miR-637	CLIP-seq
MIRT1940708	hsa-miR-1237	CLIP-seq
MIRT1940709	hsa-miR-3185	CLIP-seq
MIRT1940710	hsa-miR-3617	CLIP-seq
MIRT1940711	hsa-miR-562	CLIP-seq
MIRT1940712	hsa-miR-641	CLIP-seq
MIRT2179710	hsa-miR-3120-5p	CLIP-seq
MIRT1940710	hsa-miR-3617	CLIP-seq
MIRT2179711	hsa-miR-4521	CLIP-seq
MIRT1940712	hsa-miR-641	CLIP-seq
MIRT2384713	hsa-miR-513a-5p	CLIP-seq
MIRT2384714	hsa-miR-586	CLIP-seq
MIRT2483081	hsa-miR-1243	CLIP-seq
MIRT2483082	hsa-miR-150	CLIP-seq
MIRT2483083	hsa-miR-3064-3p	CLIP-seq
MIRT2483084	hsa-miR-3117-5p	CLIP-seq
MIRT2179710	hsa-miR-3120-5p	CLIP-seq
MIRT2483085	hsa-miR-3153	CLIP-seq
MIRT2483086	hsa-miR-3173-3p	CLIP-seq
MIRT1940709	hsa-miR-3185	CLIP-seq
MIRT2483087	hsa-miR-326	CLIP-seq
MIRT2483088	hsa-miR-330-5p	CLIP-seq
MIRT2483089	hsa-miR-34a	CLIP-seq
MIRT2483090	hsa-miR-34c-5p	CLIP-seq
MIRT1940710	hsa-miR-3617	CLIP-seq
MIRT2483091	hsa-miR-3940-5p	CLIP-seq
MIRT2483092	hsa-miR-3976	CLIP-seq
MIRT2483093	hsa-miR-3978	CLIP-seq
MIRT2483094	hsa-miR-4255	CLIP-seq
MIRT2483095	hsa-miR-4261	CLIP-seq
MIRT2483096	hsa-miR-4287	CLIP-seq
MIRT2483097	hsa-miR-4428	CLIP-seq
MIRT2483098	hsa-miR-4454	CLIP-seq
MIRT2483099	hsa-miR-4469	CLIP-seq
MIRT2483100	hsa-miR-4471	CLIP-seq
MIRT2483101	hsa-miR-4496	CLIP-seq
MIRT2483102	hsa-miR-449a	CLIP-seq
MIRT2483103	hsa-miR-449b	CLIP-seq
MIRT2483104	hsa-miR-4507	CLIP-seq
MIRT2179711	hsa-miR-4521	CLIP-seq
MIRT2483105	hsa-miR-4524	CLIP-seq
MIRT2483106	hsa-miR-4659a-5p	CLIP-seq
MIRT2483107	hsa-miR-4659b-5p	CLIP-seq
MIRT2483108	hsa-miR-4668-5p	CLIP-seq
MIRT2483109	hsa-miR-4685-3p	CLIP-seq
MIRT2483110	hsa-miR-4709-3p	CLIP-seq
MIRT2483111	hsa-miR-4738-3p	CLIP-seq
MIRT2483112	hsa-miR-4782-5p	CLIP-seq
MIRT2483113	hsa-miR-4797-5p	CLIP-seq
MIRT2483114	hsa-miR-581	CLIP-seq
MIRT2483115	hsa-miR-593	CLIP-seq
MIRT1940712	hsa-miR-641	CLIP-seq
MIRT2483116	hsa-miR-642a	CLIP-seq
MIRT2483117	hsa-miR-7	CLIP-seq
MIRT2483118	hsa-miR-875-3p	CLIP-seq
MIRT2483082	hsa-miR-150	CLIP-seq
MIRT2483083	hsa-miR-3064-3p	CLIP-seq
MIRT2483087	hsa-miR-326	CLIP-seq
MIRT2483088	hsa-miR-330-5p	CLIP-seq
MIRT2483089	hsa-miR-34a	CLIP-seq
MIRT2483090	hsa-miR-34c-5p	CLIP-seq
MIRT1940710	hsa-miR-3617	CLIP-seq
MIRT2483096	hsa-miR-4287	CLIP-seq
MIRT2483099	hsa-miR-4469	CLIP-seq
MIRT2483102	hsa-miR-449a	CLIP-seq
MIRT2483103	hsa-miR-449b	CLIP-seq
MIRT2483106	hsa-miR-4659a-5p	CLIP-seq
MIRT2483107	hsa-miR-4659b-5p	CLIP-seq
MIRT2483109	hsa-miR-4685-3p	CLIP-seq
MIRT2483112	hsa-miR-4782-5p	CLIP-seq
MIRT2483115	hsa-miR-593	CLIP-seq
MIRT1940712	hsa-miR-641	CLIP-seq
MIRT2483116	hsa-miR-642a	CLIP-seq
MIRT2483117	hsa-miR-7	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
RUNX1	Activation	22493267

Show/Hide all(12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	11707601
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0014069	Component	Postsynaptic density	IEA
GO:0016020	Component	Membrane	IEA
GO:0016528	Component	Sarcoplasm	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0045121	Component	Membrane raft	IEA
GO:0045202	Component	Synapse	IEA

MIM	HGNC	e!Ensembl
606602	14333	ENSG00000164929

Protein

UniProt ID

Q8WXS3

Protein name

Brain and acute leukemia cytoplasmic protein

Protein function

May play a synaptic role at the postsynaptic lipid rafts possibly through interaction with CAMK2A.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06989	BAALC_N	1 → 50	BAALC N-terminus	Family

Tissue specificity

TISSUE SPECIFICITY: Predominantly expressed in neuroectoderm-derived tissues. Expressed in the brain and spinal cord, and at low levels, in the adrenal gland. In the bone marrow, confined to the CD34+ progenitor cells. Not found in peripheral blood mononu

Sequence

MGCGGSRADAIEPRYYESWTRETESTWLTYTDSDAPPSAAAPDSGPEAGGLHSGMLEDGL
PSNGVPRSTAPGGIPNPEKKTNCETQCPNPQSLSSGPLTQKQNGLQTTEAKRDAKRMPAK
EVTINVTDSIQQMDRSRRITKNCVN

Sequence length

145

Interactions

View interactions

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Breast Cancer	Breast cancer and/or colorectal cancer	N/A	N/A	GWAS
Pelvic Organ Prolapse	Pelvic organ prolapse	N/A	N/A	GWAS

Show/Hide Text Mining Associations (16)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Albuminuria	Associate	35055008
Bjornstad syndrome	Associate	18378853
Death	Associate	21372155
Gastrointestinal Neoplasms	Associate	22493267
Glioblastoma	Stimulate	22493267
HAIR AN syndrome	Associate	26430723
Leukemia	Associate	12750167, 14585369, 20065290, 33453340
Leukemia Myeloid	Associate	22493267
Leukemia Myeloid Acute	Associate	12750167, 14585369, 18378853, 20026798, 20841507, 21596848, 21967978, 22493267, 22529287, 23760853, 23937207, 24326683, 24867525, 28830460, 32811810, 32862286, 33453340, 33894142 View all (3 more)
Melanoma	Stimulate	22493267
Neoplasm Residual	Associate	27662611
Neutropenia Severe Congenital Autosomal Recessive 3	Associate	33894142
Osteoarthritis	Associate	23937207
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	20065290, 22493267
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	21835957, 27662611
Triple Negative Breast Neoplasms	Stimulate	32811810

BAALC (BAALC binder of MAP3K1 and KLF4)