Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
79867
Gene name Gene Name - the full gene name approved by the HGNC.
Tectonic family member 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TCTN2
Synonyms (NCBI Gene) Gene synonyms aliases
C12orf38, JBTS24, MKS8, TECT2
Disease Acronyms (UniProt) Disease acronyms from UniProt database
JBTS24, MKS8
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q24.31
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a type I membrane protein that belongs to the tectonic family. Studies in mice suggest that this protein may be involved in hedgehog signaling, and essential for ciliogenesis. Mutations in this gene are associated with Meckel syndrome ty
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs141768405 G>A Conflicting-interpretations-of-pathogenicity, likely-benign 5 prime UTR variant
rs146698907 T>G Conflicting-interpretations-of-pathogenicity, uncertain-significance 5 prime UTR variant, missense variant, coding sequence variant
rs149430216 C>A,G Likely-benign, conflicting-interpretations-of-pathogenicity 5 prime UTR variant, synonymous variant, coding sequence variant
rs187433682 G>A Pathogenic, uncertain-significance Missense variant, intron variant, coding sequence variant
rs188417716 T>C Conflicting-interpretations-of-pathogenicity 5 prime UTR variant, synonymous variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT029239 hsa-miR-26b-5p Microarray 19088304
MIRT695166 hsa-miR-2278 HITS-CLIP 23313552
MIRT695165 hsa-miR-4768-3p HITS-CLIP 23313552
MIRT695164 hsa-miR-4459 HITS-CLIP 23313552
MIRT695163 hsa-miR-4433a-3p HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005737 Component Cytoplasm IEA
GO:0005856 Component Cytoskeleton IEA
GO:0007224 Process Smoothened signaling pathway IBA 21873635
GO:0007224 Process Smoothened signaling pathway ISS
GO:0016021 Component Integral component of membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
613846 25774 ENSG00000168778
Protein
UniProt ID Q96GX1
Protein name Tectonic-2
Protein function Component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes. Required for hedgehog signaling
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07773 DUF1619 171 444 Protein of unknown function (DUF1619) Family
Sequence
MGFQPPAALLLRLFLLQGILRLLWGDLAFIPPFIRMSGPAVSASLVGDTEGVTVSLAVLQ
DEAGILPIPTCGVLNNETEDWSVTVIPGAKVLEVTVRWKRGLDWCSSNETDSFSESPCIL
QTLLVSASHNSSCSAHLLIQVEIYANSSLTHNASENVTVIPNQVYQPLGPCPCNLTAGAC
DVRCCCDQECSSNLTTLFRRSCFTGVFGGDVNPPFDQLCSAGTTTRGVPDWFPFLCVQSP
LANTPFLGYFYHGAVSPKQDSSFEVYVDTDAKDFADFGYKQGDPIMTVKKAYFTIPQVSL
AGQCMQNAPVAFLHNFDVKCVTNLELYQERDGIINAKIKNVALGGIVTPKVIYEEATDLD
KFITNTETPLNNGSTPRIVNVEEHYIFKWNNNTISEINVKIFRAEINAHQKGIMTQRFVV
KFLSYNSGNEEELSGNPGYQLGKP
VRALNINRMNNVTTLHLWQSAGRGLCTSATFKPILF
GENVLSGCLLEVGINENCTQLRENAVERLDSLIQATHVAMRGNSDYADLSDGWLEIIRVD
APDPGADPLASSVNGMCLDIPAHLSIRILISDAGAVEGITQQEILGVETRFSSVNWQYQC
GLTCEHKADLLPISASVQFIKIPAQLPHPLTRFQINYTEYDCNRNEVCWPQLLYPWTQYY
QGELHSQCVAKGLLLLLFLTLALFLSNPWTRICKAYS
Sequence length 697
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Anchoring of the basal body to the plasma membrane
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Anencephaly Anencephaly rs773607884
Cataract Cataract rs118203965, rs118203966, rs104893685, rs121908938, rs104894175, rs121909048, rs28937573, rs121909049, rs121909050, rs74315488, rs80358200, rs80358203, rs121434643, rs56141211, rs132630322
View all (150 more)
Cerebellar vermis agenesis Familial aplasia of the vermis rs201108965, rs13297509, rs121918129, rs121918130, rs121918197, rs121918198, rs121918199, rs121918203, rs121918204, rs145665129, rs121434348, rs121434349, rs267606641, rs201391050, rs387907003
View all (121 more)
25118024, 21565611, 26092869
Cryptorchidism Cryptorchidism rs121912555, rs104894697, rs104894698, rs398122886
Unknown
Disease term Disease name Evidence References Source
Ptosis Blepharoptosis, Ptosis ClinVar
Meckel Syndrome Meckel syndrome GenCC
Associations from Text Mining
Disease Name Relationship Type References
Agenesis of Cerebellar Vermis Associate 37735380
Ciliopathies Associate 29866362
Endocardial Cushion Defects Associate 32655147
Meckel syndrome type 1 Associate 29866362, 32655147