NEK11 (NIMA related kinase 11)

Gene

• Entrez ID: 79858
• Gene name: NIMA related kinase 11
• Gene symbol: NEK11
• Synonyms (NCBI Gene): -
• Chromosome: 3
• Chromosome location: 3q22.1
• Summary: This gene encodes a member of the never in mitosis gene A family of kinases. The encoded protein localizes to the nucleoli, and may function with NEK2A in the S-phase checkpoint. The encoded protein appears to play roles in DNA replication and response to

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1180081	hsa-miR-3140-3p	CLIP-seq
MIRT1180082	hsa-miR-3149	CLIP-seq
MIRT1180083	hsa-miR-3194-3p	CLIP-seq
MIRT1180084	hsa-miR-3713	CLIP-seq
MIRT1180085	hsa-miR-4300	CLIP-seq
MIRT1180086	hsa-miR-920	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	15161910, 19734889
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	15161910, 22939624, 32707033
GO:0005524	Function	ATP binding	IDA	15161910
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA	15161910
GO:0005730	Component	Nucleolus	IEA
GO:0006468	Process	Protein phosphorylation	IDA	15161910, 19734889
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0031573	Process	Mitotic intra-S DNA damage checkpoint signaling	IBA
GO:0031573	Process	Mitotic intra-S DNA damage checkpoint signaling	IDA	15161910
GO:0035556	Process	Intracellular signal transduction	IDA	15161910
GO:0046872	Function	Metal ion binding	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	IBA
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	IMP	12154088

Other IDs

• MIM: 609779
• HGNC: 18593
• e!Ensembl: ENSG00000114670

Protein

• UniProt ID: Q8NG66
• Protein name: Serine/threonine-protein kinase Nek11 (EC 2.7.11.1) (Never in mitosis A-related kinase 11) (NimA-related protein kinase 11)
• Protein function: Protein kinase which plays an important role in the G2/M checkpoint response to DNA damage. Controls degradation of CDC25A by directly phosphorylating it on residues whose phosphorylation is required for BTRC-mediated polyubiquitination and degr
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	29 → 287	Protein kinase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Poorly expressed in cerebellum, trachea, lung, appendix, and uterus. {ECO:0000269|PubMed:12154088}.
• Sequence:

  MLKFQEAAKCVSGSTAISTYPKTLIARRYVLQQKLGSGSFGTVYLVSDKKAKRGEELKVL
  KEISVGELNPNETVQANLEAQLLSKLDHPAIVKFHASFVEQDNFCIITEYCEGRDLDDKI
  QEYKQAGKIFPENQIIEWFIQLLLGVDYMHERRILHRDLKSKNVFLKNNLLKIGDFGVSR
  LLMGSCDLATTLTGTPHYMSPEALKHQGYDTKSDIWSLACILYEMCCMNHAFAGSNFLSI
  VLKIVEGDTPSLPERYPKELNAIMESMLNKNPSLRPSAIEILKIPYLDEQLQNLMCRYSE
  MTLEDKNLDCQKEAAHIINAMQKRIHLQTLRALSEVQKMTPRERMRLRKLQAADEKARKL
  KKIVEEKYEENSKRMQELRSRNFQQLSVDVLHEKTHLKGMEEKEEQPEGRLSCSPQDEDE
  ERWQGREEESDEPTLENLPESQPIPSMDLHELESIVEDATSDLGYHEIPEDPLVAEEYYA
  DAFDSYCEESDEEEEEIALERPEKEIRNEGSQPAYRTNQQDSDIEALARCLENVLGCTSL
  DTKTITTMAEDMSPGPPIFNSVMARTKMKRMRESAMQKLGTEVFEEVYNYLKRARHQNAS
  EAEIRECLEKVVPQASDCFEVDQLLYFEEQLLITMGKEPTLQNHL

• Sequence length: 645

<

Associated diseases

Unknown
Disease merge term	Disease name	Evidence	References	Source
Insomnia	Insomnia	N/A	N/A	GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Colorectal Neoplasms	Associate	26501353
Hypoglycemia	Associate	32034166
Liver Failure	Associate	32034166
Neoplasms	Associate	40095483