NEK11 (NIMA related kinase 11)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
79858
Gene name Gene Name - the full gene name approved by the HGNC.
NIMA related kinase 11
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NEK11
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q22.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the never in mitosis gene A family of kinases. The encoded protein localizes to the nucleoli, and may function with NEK2A in the S-phase checkpoint. The encoded protein appears to play roles in DNA replication and response to
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(6)
miRTarBase ID miRNA Experiments Reference
MIRT1180081 hsa-miR-3140-3p CLIP-seq
MIRT1180082 hsa-miR-3149 CLIP-seq
MIRT1180083 hsa-miR-3194-3p CLIP-seq
MIRT1180084 hsa-miR-3713 CLIP-seq
MIRT1180085 hsa-miR-4300 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(21)
GO ID Ontology Definition Evidence Reference
GO:0004674 Function Protein serine/threonine kinase activity IBA 21873635
GO:0004674 Function Protein serine/threonine kinase activity IDA 15161910, 19734889
GO:0005515 Function Protein binding IPI 15161910
GO:0005524 Function ATP binding IDA 15161910
GO:0005634 Component Nucleus IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
609779 18593 ENSG00000114670
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q8NG66
Protein name Serine/threonine-protein kinase Nek11 (EC 2.7.11.1) (Never in mitosis A-related kinase 11) (NimA-related protein kinase 11)
Protein function Protein kinase which plays an important role in the G2/M checkpoint response to DNA damage. Controls degradation of CDC25A by directly phosphorylating it on residues whose phosphorylation is required for BTRC-mediated polyubiquitination and degr
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00069 Pkinase 29 → 287 Protein kinase domain Domain
Tissue specificity TISSUE SPECIFICITY: Poorly expressed in cerebellum, trachea, lung, appendix, and uterus. {ECO:0000269|PubMed:12154088}.
Sequence 
MLKFQEAAKCVSGSTAISTYPKTLIARRYVLQQKLGSGSFGTVYLVSDKKAKRGEELKVL
KEISVGELNPNETVQANLEAQLLSKLDHPAIVKFHASFVEQDNFCIITEYCEGRDLDDKI
QEYKQAGKIFPENQIIEWFIQLLLGVDYMHERRILHRDLKSKNVFLKNNLLKIGDFGVSR
LLMGSCDLATTLTGTPHYMSPEALKHQGYDTKSDIWSLACILYEMCCMNHAFAGSNFLSI
VLKIVEGDTPSLPERYPKELNAIMESMLNKNPSLRPSAIEILKIPYLDEQLQNLMCRYSE
MTLEDKNLDCQKEAAHIINAMQKRIHLQTLRALSEVQKMTPRERMRLRKLQAADEKARKL
KKIVEEKYEENSKRMQELRSRNFQQLSVDVLHEKTHLKGMEEKEEQPEGRLSCSPQDEDE
ERWQGREEESDEPTLENLPESQPIPSMDLHELESIVEDATSDLGYHEIPEDPLVAEEYYA
DAFDSYCEESDEEEEEIALERPEKEIRNEGSQPAYRTNQQDSDIEALARCLENVLGCTSL
DTKTITTMAEDMSPGPPIFNSVMARTKMKRMRESAMQKLGTEVFEEVYNYLKRARHQNAS
EAEIRECLEKVVPQASDCFEVDQLLYFEEQLLITMGKEPTLQNHL
Sequence length 645
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Colorectal cancer Adenocarcinoma of large intestine rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800
View all (467 more)
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Insomnia Insomnia GWAS
Show/Hide Text Mining Associations (4)
Associations from Text Mining
Disease Name Relationship Type References
Colorectal Neoplasms Associate 26501353
Hypoglycemia Associate 32034166
Liver Failure Associate 32034166
Neoplasms Associate 40095483