CCDC102B (coiled-coil domain containing 102B)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
79839
Gene name Gene Name - the full gene name approved by the HGNC.
Coiled-coil domain containing 102B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CCDC102B
Synonyms (NCBI Gene) Gene synonyms aliases
ACY1L, AN, C18orf14, HsT1731
Chromosome Chromosome number
18
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
18q22.1
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(6)
miRTarBase ID miRNA Experiments Reference
MIRT022256 hsa-miR-124-3p Microarray 18668037
MIRT867307 hsa-miR-3148 CLIP-seq
MIRT867308 hsa-miR-331-5p CLIP-seq
MIRT867309 hsa-miR-3647-3p CLIP-seq
MIRT867310 hsa-miR-3688-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(7)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 28514442, 29892012, 30404835, 31515488, 32296183
GO:0005737 Component Cytoplasm IEA
GO:0005814 Component Centriole IDA 30404835
GO:0005814 Component Centriole IEA
GO:0005856 Component Cytoskeleton IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
621147 26295 ENSG00000150636
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q68D86
Protein name Coiled-coil domain-containing protein 102B
Protein function During interphase, forms fibers at the proximal ends of centrioles to maintain centrosome cohesion (PubMed:30404835). During mitosis, dissociates from the centrosome following phosphorylation to allow centrosome separation (PubMed:30404835). Con
Family and domains
Sequence 
MNLDSIHRLIEETQIFQMQQSSIKSRGDMVAPASPPRDTCNTCFPLHGLQSHAAHNFCAH
SYNTNKWDICEELRLRELEEVKARAAQMEKTMRWWSDCTANWREKWSKVRAERNSAREEG
RQLRIKLEMAMKELSTLKKKQSLPPQKEALEAKVTQDLKLPGFVEESCEHTDQFQLSSQM
HESIREYLVKRQFSTKEDTNNKEQGVVIDSLKLSEEMKPNLDGVDLFNNGGSGNGETKTG
LRLKAINLPLENEVTEISALQVHLDEFQKILWKEREMRTALEKEIERLESALSLWKWKYE
ELKESKPKNVKEFDILLGQHNDEMQELSGNIKEESKSQNSKDRVICELRAELERLQAENT
SEWDKREILEREKQGLERENRRLKIQVKEMEELLDKKNRLSANSQSPDFKMSQIDLQEKN
QELLNLQHAYYKLNRQYQANIAELTHANNRVDQNEAEVKKLRLRVEELKQGLNQKEDELD
DSLNQIRKLQRSLDEEKERNENLETELRHLQNW
Sequence length 513
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (3)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer Breast cancer N/A N/A GWAS
Glioblastoma Glioblastoma N/A N/A GWAS
Ischemic Stroke Ischemic stroke N/A N/A GWAS
Show/Hide Text Mining Associations (6)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Blindness Associate 29725004
Breast Neoplasms Associate 36936167
Macular Degeneration Associate 29725004
Muscular Disorders Atrophic Associate 29725004
Myopia Associate 29725004
Vision Low Associate 29725004