KDM8 (lysine demethylase 8)

Gene
Gene miRNA Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
79831
Gene name Gene Name - the full gene name approved by the HGNC.
Lysine demethylase 8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KDM8
Synonyms (NCBI Gene) Gene synonyms aliases
JMJD5
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16p12.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene likely encodes a histone lysine demethylase. Studies of a similar protein in mouse indicate a potential role for this protein as a tumor suppressor. Alternatively spliced transcript variants have been described.[provided by RefSeq, Feb 2009]
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all(2)
miRTarBase ID miRNA Experiments Reference
MIRT045429 hsa-miR-149-5p CLASH 23622248
MIRT052832 hsa-miR-378c CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all(24)
GO ID Ontology Definition Evidence Reference
GO:0000086 Process G2/M transition of mitotic cell cycle IMP 20457893
GO:0003682 Function Chromatin binding IDA 20457893
GO:0004175 Function Endopeptidase activity IDA 28847961
GO:0004177 Function Aminopeptidase activity IDA 28847961
GO:0005515 Function Protein binding IPI 24981860
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
611917 25840 ENSG00000155666
Protein
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Q8N371
Protein name Bifunctional peptidase and arginyl-hydroxylase JMJD5 (EC 1.14.11.73) (EC 3.4.-.-) (JmjC domain-containing protein 5) (Jumonji C domain-containing protein 5) (L-arginine (3R)-hydroxylase KDM8)
Protein function Bifunctional enzyme that acts both as an endopeptidase and 2-oxoglutarate-dependent monooxygenase (PubMed:28847961, PubMed:28982940, PubMed:29459673, PubMed:29563586). Endopeptidase that cleaves histones N-terminal tails at the carboxyl side of
PDB 3UYJ , 4AAP , 4GAZ , 4GJY , 4GJZ , 4QU1 , 5FBJ , 6AVS , 6AX3 , 6F4M , 6F4N , 6F4O , 6F4P , 6F4Q , 6F4R , 6F4S , 6F4T , 6I9L , 6I9M , 6I9N , 7DYT , 7DYU , 7DYV , 7DYW , 7DYX , 7UQ3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13621 Cupin_8 192 → 416 Cupin-like domain Domain
Tissue specificity TISSUE SPECIFICITY: Weakly expressed in most cells. Highly expressed in breast cancer cells (PubMed:20457893). Expressed in embryonic stem cells (PubMed:24740926). {ECO:0000269|PubMed:20457893, ECO:0000269|PubMed:24740926}.
Sequence 
MAGDTHCPAEPLAREGTLWEALRALLPHSKEDLKLDLGEKVERSVVTLLQRATELFYEGR
RDECLQSSEVILDYSWEKLNTGTWQDVDKDWRRVYAIGCLLKALCLCQAPEDANTVAAAL
RVCDMGLLMGAAILGDILLKVAAILQTHLPGKRPARGSLPEQPCTKKARADHGLIPDVKL
EKTVPRLHRPSLQHFREQFLVPGRPVILKGVADHWPCMQKWSLEYIQEIAGCRTVPVEVG
SRYTDEEWSQTLMTVNEFISKYIVNEPRDVGYLAQHQLFDQIPELKQDISIPDYCSLGDG
EEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKYIRLYSPQESGALYPHDTHLLHNT
SQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYWHYVRALDLSFSVSFWWS
Sequence length 416
Interactions View interactions