CLMP (CXADR like cell adhesion molecule)

Gene
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
79827
Gene name Gene Name - the full gene name approved by the HGNC.
CXADR like cell adhesion molecule
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CLMP
Synonyms (NCBI Gene) Gene synonyms aliases
ACAM, ASAM, CSBM, CSBS
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q24.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a type I transmembrane protein that is localized to junctional complexes between endothelial and epithelial cells and may have a role in cell-cell adhesion. Expression of this gene in white adipose tissue is implicated in adipocyte matur
SNPs SNP information provided by dbSNP.
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(7)
SNP ID Visualize variation Clinical significance Consequence
rs587776964 T>- Pathogenic Coding sequence variant, frameshift variant
rs587776965 C>T Pathogenic Coding sequence variant, missense variant
rs587776966 G>A Pathogenic Coding sequence variant, stop gained
rs587776967 A>G,T Pathogenic Coding sequence variant, missense variant
rs765907815 G>A,C Pathogenic Missense variant, coding sequence variant, stop gained
miRNA miRNA information provided by mirtarbase database.
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(398)
miRTarBase ID miRNA Experiments Reference
MIRT022869 hsa-miR-124-3p Microarray 18668037
MIRT643395 hsa-miR-877-3p HITS-CLIP 23824327
MIRT643393 hsa-miR-4635 HITS-CLIP 23824327
MIRT643394 hsa-miR-324-5p HITS-CLIP 23824327
MIRT643392 hsa-miR-520d-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(13)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005881 Component Cytoplasmic microtubule IDA 23264731
GO:0005881 Component Cytoplasmic microtubule IEA
GO:0005886 Component Plasma membrane IEA
GO:0005923 Component Bicellular tight junction IDA 22155368
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
611693 24039 ENSG00000166250
Protein
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q9H6B4
Protein name CXADR-like membrane protein (Adipocyte adhesion molecule) (Coxsackie- and adenovirus receptor-like membrane protein) (CAR-like membrane protein)
Protein function May be involved in the cell-cell adhesion. May play a role in adipocyte differentiation and development of obesity. Is required for normal small intestine development. {ECO:0000269|PubMed:14573622, ECO:0000269|PubMed:15563274, ECO:0000269|PubMed
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 18 → 129 Immunoglobulin V-set domain Domain
PF13895 Ig_2 129 → 225 Immunoglobulin domain Domain
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed in epithelial cells within different tissues and in the white adipose tissue. Expressed at high levels in small intestine and placenta, at intermediate levels in the heart, skeletal muscle, colon, spleen, kidney
Sequence 
MSLLLLLLLVSYYVGTLGTHTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQ
KVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYV
WSHVILKVLVRPSKPKCELEGELTEGSDLTLQCESSSGTEPIVYYWQRIREKEGEDERLP
PKSRIDYNHPGRVLLQNLTMSYSGLYQCTAGNEAGKESCVVRVTVQYVQSIGMVAGAVTG
IVAGALLIFLLVWLLIRRKDKERYEEEERPNEIREDAEAPKARLVKPSSSSSGSRSSRSG
SSSTRSTANSASRSQRTLSTDAAPQPGLATQAYSLVGPEVRGSEPKKVHHANLTKAETTP
SMIPSQSRAFQTV
Sequence length 373
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Intestinal Pseudoobstruction intestinal pseudo-obstruction rs587776966, rs765907815 N/A
Show/Hide Unknown Diseases (4)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer Breast cancer N/A N/A GWAS
Colorectal Cancer Colorectal cancer N/A N/A GWAS
Glioblastoma Glioblastoma N/A N/A GWAS
Oligodendroglioma Oligodendroglioma N/A N/A GWAS
Show/Hide Text Mining Associations (9)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Colitis Ulcerative Associate 33793617
Colorectal Neoplasms Associate 32859214
Dermatitis Allergic Contact Inhibit 31783056
Inflammation Associate 33793617
Inflammation Stimulate 36241608
Intestinal Pseudo Obstruction Associate 23037936
Multiple Sclerosis Associate 36241608
Neuroinflammatory Diseases Associate 36241608
Pancreatic Neoplasms Associate 37588985