Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	79817
Gene name	MOB kinase activator 3B
Gene symbol	MOB3B
Synonyms (NCBI Gene)	C9orf35MOB1DMOBKL2B
Chromosome	9
Chromosome location	9p21.2
Summary	The protein encoded by this gene shares similarity with the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. This gene is located on the opposite strand as the inte

Show/Hide all (57)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021972	hsa-miR-128-3p	Microarray	17612493
MIRT023324	hsa-miR-122-5p	Microarray	17612493
MIRT025174	hsa-miR-181a-5p	Microarray	17612493
MIRT027623	hsa-miR-98-5p	Microarray	19088304
MIRT442528	hsa-miR-409-3p	PAR-CLIP	22100165
MIRT442527	hsa-miR-33a-3p	PAR-CLIP	22100165
MIRT442525	hsa-miR-2114-5p	PAR-CLIP	22100165
MIRT442526	hsa-miR-4307	PAR-CLIP	22100165
MIRT442524	hsa-miR-2052	PAR-CLIP	22100165
MIRT442523	hsa-miR-19a-5p	PAR-CLIP	22100165
MIRT442522	hsa-miR-19b-1-5p	PAR-CLIP	22100165
MIRT442521	hsa-miR-19b-2-5p	PAR-CLIP	22100165
MIRT442520	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT442519	hsa-miR-4776-3p	PAR-CLIP	22100165
MIRT442534	hsa-miR-148a-5p	PAR-CLIP	22100165
MIRT442533	hsa-miR-455-5p	PAR-CLIP	22100165
MIRT442532	hsa-miR-1227-3p	PAR-CLIP	22100165
MIRT442531	hsa-miR-6875-3p	PAR-CLIP	22100165
MIRT442530	hsa-miR-4659a-3p	PAR-CLIP	22100165
MIRT442529	hsa-miR-4659b-3p	PAR-CLIP	22100165
MIRT442528	hsa-miR-409-3p	PAR-CLIP	22100165
MIRT442527	hsa-miR-33a-3p	PAR-CLIP	22100165
MIRT442525	hsa-miR-2114-5p	PAR-CLIP	22100165
MIRT442526	hsa-miR-4307	PAR-CLIP	22100165
MIRT442524	hsa-miR-2052	PAR-CLIP	22100165
MIRT442523	hsa-miR-19a-5p	PAR-CLIP	22100165
MIRT442522	hsa-miR-19b-1-5p	PAR-CLIP	22100165
MIRT442521	hsa-miR-19b-2-5p	PAR-CLIP	22100165
MIRT442520	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT442519	hsa-miR-4776-3p	PAR-CLIP	22100165
MIRT734440	hsa-miR-495-3p	Immunohistochemistry (IHC)Immunoprecipitaion (IP)Luciferase reporter assayWestern blotting	33087165
MIRT442528	hsa-miR-409-3p	PAR-CLIP	22100165
MIRT442527	hsa-miR-33a-3p	PAR-CLIP	22100165
MIRT442525	hsa-miR-2114-5p	PAR-CLIP	22100165
MIRT442526	hsa-miR-4307	PAR-CLIP	22100165
MIRT442524	hsa-miR-2052	PAR-CLIP	22100165
MIRT442523	hsa-miR-19a-5p	PAR-CLIP	22100165
MIRT442522	hsa-miR-19b-1-5p	PAR-CLIP	22100165
MIRT442521	hsa-miR-19b-2-5p	PAR-CLIP	22100165
MIRT442520	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT442519	hsa-miR-4776-3p	PAR-CLIP	22100165
MIRT442534	hsa-miR-148a-5p	PAR-CLIP	22100165
MIRT442533	hsa-miR-455-5p	PAR-CLIP	22100165
MIRT442532	hsa-miR-1227-3p	PAR-CLIP	22100165
MIRT442531	hsa-miR-6875-3p	PAR-CLIP	22100165
MIRT442530	hsa-miR-4659a-3p	PAR-CLIP	22100165
MIRT442529	hsa-miR-4659b-3p	PAR-CLIP	22100165
MIRT442528	hsa-miR-409-3p	PAR-CLIP	22100165
MIRT442527	hsa-miR-33a-3p	PAR-CLIP	22100165
MIRT442525	hsa-miR-2114-5p	PAR-CLIP	22100165
MIRT442526	hsa-miR-4307	PAR-CLIP	22100165
MIRT442524	hsa-miR-2052	PAR-CLIP	22100165
MIRT442523	hsa-miR-19a-5p	PAR-CLIP	22100165
MIRT442522	hsa-miR-19b-1-5p	PAR-CLIP	22100165
MIRT442521	hsa-miR-19b-2-5p	PAR-CLIP	22100165
MIRT442520	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT442519	hsa-miR-4776-3p	PAR-CLIP	22100165

Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 19060904, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0007165	Process	Signal transduction	IBA
GO:0030295	Function	Protein kinase activator activity	IBA
GO:0035330	Process	Regulation of hippo signaling	IMP	28792927
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
617652	23825	ENSG00000120162

Q86TA1

Protein name

MOB kinase activator 3B (Mob1 homolog 2b) (Mps one binder kinase activator-like 2B) (MOB kinase activator-like 2B)

Protein function

Modulates LATS1 expression in the Hippo signaling pathway which plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03637	Mob1_phocein	35 → 207	Mob1/phocein family	Family

Sequence

MSIALKQVFNKDKTFRPKRKFEPGTQRFELHKRAQASLNSGVDLKAAVQLPSGEDQNDWV
AVHVVDFFNRINLIYGTICEFCTERTCPVMSGGPKYEYRWQDDLKYKKPTALPAPQYMNL
LMDWIEVQINNEEIFPTCVGVPFPKNFLQICKKILCRLFRVFVHVYIHHFDRVIVMGAEA
HVNTCYKHFYYFVTEMNLIDRKELEPLKEMTSRMCH

Sequence length

216

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (13)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FRONTOTEMPORAL DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMOLYTIC ANEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (6)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Amyotrophic Lateral Sclerosis	Associate	23587638, 34475377	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Associate	35381768	★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Associate	34475377, 37979250	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma Mantle Cell	Associate	18984860, 20421449	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	26130958, 28084441, 30866497	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Alveolar	Associate	36232302	★★★★★ ★☆☆☆☆ Found in Text Mining only

MOB3B (MOB kinase activator 3B)