Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
79816
Gene name Gene Name - the full gene name approved by the HGNC.
TLE family member 6, subcortical maternal complex member
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TLE6
Synonyms (NCBI Gene) Gene synonyms aliases
GRG6, OZEMA15, PREMBL
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the Groucho/ transducin-like Enhancer of split family of transcriptional co-repressors. The encoded protein is a component of the mammalian subcortical maternal complex, which is required for preimplantation development. In m
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs767222404 C>A,G Pathogenic Missense variant, coding sequence variant, genic downstream transcript variant
rs776453307 C>- Pathogenic Frameshift variant, coding sequence variant, genic downstream transcript variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1426356 hsa-miR-3064-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II ISS
GO:0003714 Function Transcription corepressor activity IBA
GO:0005515 Function Protein binding IPI 25542835, 26537248, 32814053
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612399 30788 ENSG00000104953
Protein
UniProt ID Q9H808
Protein name Transducin-like enhancer protein 6
Protein function Component of the subcortical maternal complex (SCMC), a multiprotein complex that plays a key role in early embryonic development (PubMed:26537248). The SCMC complex is a structural constituent of cytoplasmic lattices, which consist in fibrous s
PDB 8X7V , 8X7W
Family and domains
Sequence
MTSRDQPRPKGPPKSTSPCPGISNSESSPTLNYQGILNRLKQFPRFSPHFAAELESIYYS
LHKIQQDVAEHHKQIGNVLQIVESCSQLQGFQSEEVSPAEPASPGTPQQVKDKTLQESSF
EDIMATRSSDWLRRPLGEDNQPETQLFWDKEPWFWHDTLTEQLWRIFAGVHDEKAKPRDR
QQAPGLGQESKAPGSCDPGTDPCPEDASTPRPPEASSSPPEGSQDRNTSWGVVQEPPGRA
SRFLQSISWDPEDFEDAWKRPDALPGQSKRLAVPCKLEKMRILAHGELVLATAISSFTRH
VFTCGRRGIKVWSLTGQVAEDRFPESHLPIQTPGAFLRTCLLSSNSRSLLTGGYNLASVS
VWDLAAPSLHVKEQLPCAGLNCQALDANLDANLAFASFTSGVVRIWDLRDQSVVRDLKGY
PDGVKSIVVKGYNIWTGGPDACLRCWDQRTIMKPLEYQFKSQIMSLSHSPQEDWVLLGMA
NGQQWLQSTSGSQRHMVGQKDSVILSVKFSPFGQWWASVGMDDFLGVYSMPAGTKVFEVP
EMSPVTCCDVSSNNRLVVTGSGEHASVYQITY
Sequence length 572
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Wnt signaling pathway
Notch signaling pathway
 
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Preimplantation Embryonic Lethality preimplantation embryonic lethality 1 rs767222404, rs776453307, rs752098612 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Oligodendroglioma Oligodendroglioma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Autistic Disorder Associate 19454485
Carcinoma Embryonal Associate 34036456, 35946397, 36271123, 40225929
Colorectal Neoplasms Associate 34373442
Diabetes Mellitus Type 2 Associate 35946397
Early Onset Glaucoma Associate 35946397
Infertility Associate 34036456
Infertility Female Associate 31897846, 34036456, 34264011, 36271123, 40225929
Renal Insufficiency Associate 31897846, 32840018, 33073652, 34036456, 34264011, 35946397, 36271123