Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	79811
Gene name Gene Name - the full gene name approved by the HGNC.	SAFB like transcription modulator
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLTM
Synonyms (NCBI Gene) Gene synonyms aliases	Met
Chromosome Chromosome number	15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	15q22.1

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1401798992	G>C,T	Likely-pathogenic	Downstream transcript variant, non coding transcript variant, coding sequence variant, missense variant, genic downstream transcript variant

Show/Hide all(214)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021156	hsa-miR-186-5p	Sequencing	20371350
MIRT1370164	hsa-miR-101	CLIP-seq
MIRT1370165	hsa-miR-105	CLIP-seq
MIRT1370166	hsa-miR-1237	CLIP-seq
MIRT1370167	hsa-miR-1250	CLIP-seq
MIRT1370168	hsa-miR-1297	CLIP-seq
MIRT1370169	hsa-miR-1305	CLIP-seq
MIRT1370170	hsa-miR-132	CLIP-seq
MIRT1370171	hsa-miR-148a	CLIP-seq
MIRT1370172	hsa-miR-148b	CLIP-seq
MIRT1370173	hsa-miR-152	CLIP-seq
MIRT1370174	hsa-miR-194	CLIP-seq
MIRT1370175	hsa-miR-200b	CLIP-seq
MIRT1370176	hsa-miR-200c	CLIP-seq
MIRT1370177	hsa-miR-212	CLIP-seq
MIRT1370178	hsa-miR-2276	CLIP-seq
MIRT1370179	hsa-miR-26a	CLIP-seq
MIRT1370180	hsa-miR-26b	CLIP-seq
MIRT1370181	hsa-miR-3647-3p	CLIP-seq
MIRT1370182	hsa-miR-3671	CLIP-seq
MIRT1370183	hsa-miR-3692	CLIP-seq
MIRT1370184	hsa-miR-369-3p	CLIP-seq
MIRT1370185	hsa-miR-377	CLIP-seq
MIRT1370186	hsa-miR-3909	CLIP-seq
MIRT1370187	hsa-miR-4257	CLIP-seq
MIRT1370188	hsa-miR-429	CLIP-seq
MIRT1370189	hsa-miR-4436b-5p	CLIP-seq
MIRT1370190	hsa-miR-4465	CLIP-seq
MIRT1370191	hsa-miR-455-5p	CLIP-seq
MIRT1370192	hsa-miR-4700-3p	CLIP-seq
MIRT1370193	hsa-miR-4724-3p	CLIP-seq
MIRT1370194	hsa-miR-4766-3p	CLIP-seq
MIRT1370195	hsa-miR-4768-3p	CLIP-seq
MIRT1370196	hsa-miR-4772-3p	CLIP-seq
MIRT1370197	hsa-miR-495	CLIP-seq
MIRT1370198	hsa-miR-5095	CLIP-seq
MIRT1370199	hsa-miR-510	CLIP-seq
MIRT1370200	hsa-miR-512-5p	CLIP-seq
MIRT1370201	hsa-miR-513c	CLIP-seq
MIRT1370202	hsa-miR-514b-5p	CLIP-seq
MIRT1370203	hsa-miR-518d-5p	CLIP-seq
MIRT1370204	hsa-miR-519b-5p	CLIP-seq
MIRT1370205	hsa-miR-519c-5p	CLIP-seq
MIRT1370206	hsa-miR-520c-5p	CLIP-seq
MIRT1370207	hsa-miR-526a	CLIP-seq
MIRT1370208	hsa-miR-544	CLIP-seq
MIRT1370209	hsa-miR-548ad	CLIP-seq
MIRT1370210	hsa-miR-550a	CLIP-seq
MIRT1370211	hsa-miR-561	CLIP-seq
MIRT1370212	hsa-miR-562	CLIP-seq
MIRT1370213	hsa-miR-607	CLIP-seq
MIRT1370214	hsa-miR-618	CLIP-seq
MIRT1370215	hsa-miR-629	CLIP-seq
MIRT1370165	hsa-miR-105	CLIP-seq
MIRT1370167	hsa-miR-1250	CLIP-seq
MIRT1370169	hsa-miR-1305	CLIP-seq
MIRT1370216	hsa-miR-154	CLIP-seq
MIRT1370175	hsa-miR-200b	CLIP-seq
MIRT1370176	hsa-miR-200c	CLIP-seq
MIRT1370178	hsa-miR-2276	CLIP-seq
MIRT1370217	hsa-miR-2355-5p	CLIP-seq
MIRT1370218	hsa-miR-300	CLIP-seq
MIRT1370182	hsa-miR-3671	CLIP-seq
MIRT1370184	hsa-miR-369-3p	CLIP-seq
MIRT1370219	hsa-miR-381	CLIP-seq
MIRT1370220	hsa-miR-4286	CLIP-seq
MIRT1370188	hsa-miR-429	CLIP-seq
MIRT1370191	hsa-miR-455-5p	CLIP-seq
MIRT1370221	hsa-miR-4672	CLIP-seq
MIRT1370222	hsa-miR-4696	CLIP-seq
MIRT1370223	hsa-miR-4699-3p	CLIP-seq
MIRT1370192	hsa-miR-4700-3p	CLIP-seq
MIRT1370195	hsa-miR-4768-3p	CLIP-seq
MIRT1370198	hsa-miR-5095	CLIP-seq
MIRT1370199	hsa-miR-510	CLIP-seq
MIRT1370200	hsa-miR-512-5p	CLIP-seq
MIRT1370224	hsa-miR-520d-5p	CLIP-seq
MIRT1370225	hsa-miR-524-5p	CLIP-seq
MIRT1370209	hsa-miR-548ad	CLIP-seq
MIRT1370210	hsa-miR-550a	CLIP-seq
MIRT1370211	hsa-miR-561	CLIP-seq
MIRT1370213	hsa-miR-607	CLIP-seq
MIRT1370164	hsa-miR-101	CLIP-seq
MIRT1370166	hsa-miR-1237	CLIP-seq
MIRT1370168	hsa-miR-1297	CLIP-seq
MIRT1370170	hsa-miR-132	CLIP-seq
MIRT1370216	hsa-miR-154	CLIP-seq
MIRT1370174	hsa-miR-194	CLIP-seq
MIRT1370175	hsa-miR-200b	CLIP-seq
MIRT1370176	hsa-miR-200c	CLIP-seq
MIRT1370177	hsa-miR-212	CLIP-seq
MIRT1370178	hsa-miR-2276	CLIP-seq
MIRT1370179	hsa-miR-26a	CLIP-seq
MIRT1370180	hsa-miR-26b	CLIP-seq
MIRT1370181	hsa-miR-3647-3p	CLIP-seq
MIRT1370184	hsa-miR-369-3p	CLIP-seq
MIRT1370186	hsa-miR-3909	CLIP-seq
MIRT2109918	hsa-miR-3929	CLIP-seq
MIRT1370187	hsa-miR-4257	CLIP-seq
MIRT1370188	hsa-miR-429	CLIP-seq
MIRT2109919	hsa-miR-4325	CLIP-seq
MIRT2109920	hsa-miR-4419b	CLIP-seq
MIRT1370190	hsa-miR-4465	CLIP-seq
MIRT2109921	hsa-miR-4478	CLIP-seq
MIRT1370221	hsa-miR-4672	CLIP-seq
MIRT2109922	hsa-miR-4680-5p	CLIP-seq
MIRT1370193	hsa-miR-4724-3p	CLIP-seq
MIRT1370196	hsa-miR-4772-3p	CLIP-seq
MIRT1370199	hsa-miR-510	CLIP-seq
MIRT1370200	hsa-miR-512-5p	CLIP-seq
MIRT1370201	hsa-miR-513c	CLIP-seq
MIRT1370202	hsa-miR-514b-5p	CLIP-seq
MIRT1370208	hsa-miR-544	CLIP-seq
MIRT1370211	hsa-miR-561	CLIP-seq
MIRT1370212	hsa-miR-562	CLIP-seq
MIRT1370164	hsa-miR-101	CLIP-seq
MIRT2333265	hsa-miR-106a	CLIP-seq
MIRT2333266	hsa-miR-106b	CLIP-seq
MIRT1370166	hsa-miR-1237	CLIP-seq
MIRT1370168	hsa-miR-1297	CLIP-seq
MIRT1370170	hsa-miR-132	CLIP-seq
MIRT2333267	hsa-miR-17	CLIP-seq
MIRT1370174	hsa-miR-194	CLIP-seq
MIRT2333268	hsa-miR-20a	CLIP-seq
MIRT2333269	hsa-miR-20b	CLIP-seq
MIRT1370177	hsa-miR-212	CLIP-seq
MIRT1370178	hsa-miR-2276	CLIP-seq
MIRT1370179	hsa-miR-26a	CLIP-seq
MIRT1370180	hsa-miR-26b	CLIP-seq
MIRT1370185	hsa-miR-377	CLIP-seq
MIRT1370186	hsa-miR-3909	CLIP-seq
MIRT1370187	hsa-miR-4257	CLIP-seq
MIRT2109919	hsa-miR-4325	CLIP-seq
MIRT1370190	hsa-miR-4465	CLIP-seq
MIRT1370221	hsa-miR-4672	CLIP-seq
MIRT1370193	hsa-miR-4724-3p	CLIP-seq
MIRT1370196	hsa-miR-4772-3p	CLIP-seq
MIRT1370201	hsa-miR-513c	CLIP-seq
MIRT1370202	hsa-miR-514b-5p	CLIP-seq
MIRT2333270	hsa-miR-519a	CLIP-seq
MIRT2333271	hsa-miR-519b-3p	CLIP-seq
MIRT2333272	hsa-miR-519c-3p	CLIP-seq
MIRT2333273	hsa-miR-519d	CLIP-seq
MIRT1370208	hsa-miR-544	CLIP-seq
MIRT1370209	hsa-miR-548ad	CLIP-seq
MIRT2333274	hsa-miR-548n	CLIP-seq
MIRT2333275	hsa-miR-548t	CLIP-seq
MIRT1370212	hsa-miR-562	CLIP-seq
MIRT2333276	hsa-miR-93	CLIP-seq
MIRT1370192	hsa-miR-4700-3p	CLIP-seq
MIRT1370195	hsa-miR-4768-3p	CLIP-seq
MIRT1370198	hsa-miR-5095	CLIP-seq
MIRT1370211	hsa-miR-561	CLIP-seq
MIRT2440560	hsa-miR-140-3p	CLIP-seq
MIRT2440561	hsa-miR-610	CLIP-seq
MIRT1370165	hsa-miR-105	CLIP-seq
MIRT1370167	hsa-miR-1250	CLIP-seq
MIRT1370169	hsa-miR-1305	CLIP-seq
MIRT2627529	hsa-miR-1323	CLIP-seq
MIRT2440560	hsa-miR-140-3p	CLIP-seq
MIRT1370178	hsa-miR-2276	CLIP-seq
MIRT1370182	hsa-miR-3671	CLIP-seq
MIRT1370185	hsa-miR-377	CLIP-seq
MIRT2627530	hsa-miR-4461	CLIP-seq
MIRT1370191	hsa-miR-455-5p	CLIP-seq
MIRT1370222	hsa-miR-4696	CLIP-seq
MIRT2627531	hsa-miR-4731-3p	CLIP-seq
MIRT2627532	hsa-miR-4801	CLIP-seq
MIRT2627533	hsa-miR-515-5p	CLIP-seq
MIRT2627534	hsa-miR-539	CLIP-seq
MIRT1370209	hsa-miR-548ad	CLIP-seq
MIRT2333274	hsa-miR-548n	CLIP-seq
MIRT2627535	hsa-miR-548o	CLIP-seq
MIRT2333275	hsa-miR-548t	CLIP-seq
MIRT1370210	hsa-miR-550a	CLIP-seq
MIRT2627536	hsa-miR-580	CLIP-seq
MIRT2627537	hsa-miR-606	CLIP-seq
MIRT1370213	hsa-miR-607	CLIP-seq
MIRT2440561	hsa-miR-610	CLIP-seq
MIRT2627538	hsa-miR-942	CLIP-seq
MIRT1370165	hsa-miR-105	CLIP-seq
MIRT1370167	hsa-miR-1250	CLIP-seq
MIRT1370169	hsa-miR-1305	CLIP-seq
MIRT2627529	hsa-miR-1323	CLIP-seq
MIRT2440560	hsa-miR-140-3p	CLIP-seq
MIRT1370182	hsa-miR-3671	CLIP-seq
MIRT1370185	hsa-miR-377	CLIP-seq
MIRT2691346	hsa-miR-3926	CLIP-seq
MIRT1370187	hsa-miR-4257	CLIP-seq
MIRT2691347	hsa-miR-433	CLIP-seq
MIRT2627530	hsa-miR-4461	CLIP-seq
MIRT1370191	hsa-miR-455-5p	CLIP-seq
MIRT2109922	hsa-miR-4680-5p	CLIP-seq
MIRT2627531	hsa-miR-4731-3p	CLIP-seq
MIRT2627532	hsa-miR-4801	CLIP-seq
MIRT2691348	hsa-miR-494	CLIP-seq
MIRT1370197	hsa-miR-495	CLIP-seq
MIRT2691349	hsa-miR-513a-3p	CLIP-seq
MIRT1370201	hsa-miR-513c	CLIP-seq
MIRT1370202	hsa-miR-514b-5p	CLIP-seq
MIRT2627533	hsa-miR-515-5p	CLIP-seq
MIRT2627534	hsa-miR-539	CLIP-seq
MIRT1370209	hsa-miR-548ad	CLIP-seq
MIRT2333274	hsa-miR-548n	CLIP-seq
MIRT2627535	hsa-miR-548o	CLIP-seq
MIRT2691350	hsa-miR-548s	CLIP-seq
MIRT2333275	hsa-miR-548t	CLIP-seq
MIRT1370210	hsa-miR-550a	CLIP-seq
MIRT2627536	hsa-miR-580	CLIP-seq
MIRT2627537	hsa-miR-606	CLIP-seq
MIRT1370213	hsa-miR-607	CLIP-seq
MIRT2440561	hsa-miR-610	CLIP-seq
MIRT2691351	hsa-miR-659	CLIP-seq
MIRT2627538	hsa-miR-942	CLIP-seq

Show/Hide all(12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006915	Process	Apoptotic process	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0043565	Function	Sequence-specific DNA binding	IBA
GO:0050684	Process	Regulation of mRNA processing	IBA

MIM	HGNC	e!Ensembl
620992	20709	ENSG00000137776

Protein

UniProt ID

Q9NWH9

Protein name

SAFB-like transcription modulator (Modulator of estrogen-induced transcription)

Protein function

When overexpressed, acts as a general inhibitor of transcription that eventually leads to apoptosis.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02037	SAP	22 → 56	SAP domain	Family
PF00076	RRM_1	386 → 456	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain

Sequence

MAAATGAVAASAASGQAEGKKITDLRVIDLKSELKRRNLDITGVKTVLISRLKQAIEEEG
GDPDNIELTVSTDTPNKKPTKGKGKKHEADELSGDASVEDDAFIKDCELENQEAHEQDGN
DELKDSEEFGENEEENVHSKELLSAEENKRAHELIEAEGIEDIEKEDIESQEIEAQEGED
DTFLTAQDGEEEENEKDIAGSGDGTQEVSKPLPSEGSLAEADHTAHEEMEAHTTVKEAED
DNISVTIQAEDAITLDFDGDDLLETGKNVKITDSEASKPKDGQDAIAQSPEKESKDYEMN
ANHKDGKKEDCVKGDPVEKEARESSKKAESGDKEKDTLKKGPSSTGASGQAKSSSKESKD
SKTSSKDDKGSTSSTSGSSGSSTKNIWVSGLSSNTKAADLKNLFGKYGKVLSAKVVTNAR
SPGAKCYGIVTMSSSTEVSRCIAHLHRTELHGQLISVEKVKGDPSKKEMKKENDEKSSSR
SSGDKKNTSDRSSKTQASVKKEEKRSSEKSEKKESKDTKKIEGKDEKNDNGASGQTSESI
KKSEEKKRISSKSPGHMVILDQTKGDHCRPSRRGRYEKIHGRSKEKERASLDKKRDKDYR
RKEILPFEKMKEQRLREHLVRFERLRRAMELRRRREIAERERRERERIRIIREREERERL
QRERERLEIERQKLERERMERERLERERIRIEQERRKEAERIAREREELRRQQQQLRYEQ
EKRNSLKRPRDVDHRRDDPYWSENKKLSLDTDARFGHGSDYSRQQNRFNDFDHRERGRFP
ESSAVQSSSFERRDRFVGQSEGKKARPTARREDPSFERYPKNFSDSRRNEPPPPRNELRE
SDRREVRGERDERRTVIIHDRPDITHPRHPREAGPNPSRPTSWKSEGSMSTDKRETRVER
PERSGREVSGHSVRGAPPGNRSSASGYGSREGDRGVITDRGGGSQHYPEERHVVERHGRD
TSGPRKEWHGPPSQGPSYHDTRRMGDGRAGAGMITQHSSNASPINRIVQISGNSMPRGSG
SGFKPFKGGPPRRF

Sequence length

1034

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Jeune Thoracic Dystrophy	jeune thoracic dystrophy	rs1401798992	N/A

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Schizophrenia	Schizophrenia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (257)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Abnormalities Drug Induced	Associate	25087088
Adenocarcinoma	Associate	15720819, 17062664, 18349821, 18379349, 19096300, 22042947, 22052229, 22198430, 22450065, 23449277, 25886066, 26183759, 26315110, 27080983, 27300295 View all (17 more)
Adenocarcinoma Clear Cell	Associate	21478826, 21983935
Adenocarcinoma Mucinous	Associate	32840168
Adenocarcinoma Of Esophagus	Associate	16327494
Adenocarcinoma of Lung	Associate	18093943, 19096300, 20150826, 22975805, 25079552, 25886066, 25922291, 25971939, 26066407, 26098749, 26416301, 26791794, 26845116, 27060149, 27151654 View all (39 more)
Adenocarcinoma of Lung	Stimulate	19817696
Adenoma	Associate	34801057
Adenoma Pleomorphic	Associate	33838468
Adenomatous Polyposis Coli	Associate	28141798
Adrenocortical Carcinoma	Associate	25087088, 35462410
Allergic Fungal Sinusitis	Stimulate	22416915
Allergic Fungal Sinusitis	Associate	22416915
Alzheimer Disease	Stimulate	18786162
Alzheimer Disease	Associate	20593467, 24384148
Anemia Hemolytic	Associate	24939847
Aneuploidy	Associate	34303217, 34677235
Anxiety Disorders	Associate	24247044
Aplasia of Lacrimal and Salivary Glands	Associate	25899808
Arthrogryposis	Associate	30777867
Astrocytoma	Associate	11296484, 22672415, 30996153, 39357189
Asymptomatic Diseases	Associate	36810936
Atrial Fibrillation	Associate	36341343
Autism Spectrum Disorder	Associate	19360663, 19548256, 22958829, 23097380, 24150225
Autism Spectrum Disorder	Inhibit	21832174
Autistic Disorder	Associate	17053076, 19002214, 19548256, 20080979, 21832174, 22110649, 22558359, 22833194, 22958829, 23097380, 27086544, 28507316
Barrett Esophagus	Associate	15720819
Bile Duct Diseases	Associate	7573364
Biliary Tract Neoplasms	Associate	32447492, 37326363
Bone Diseases	Associate	23431957, 28334277
Brain Ischemia	Associate	25418580
Brain Neoplasms	Associate	20489150, 27693535, 33335011, 34812554, 36749292
Breast Neoplasms	Associate	12475979, 12673709, 12793903, 17260003, 18160707, 18381931, 18499206, 18564920, 22105362, 22379025, 22850551, 22869872, 23049908, 23063927, 23825050 View all (17 more)
Breast Neoplasms	Stimulate	30004628
Breast Neoplasms	Inhibit	33108409
Breast Neoplasms Male	Associate	23308200
Calcinosis Cutis	Associate	27894094, 30463996, 32820577, 8104462
Carcinogenesis	Associate	16189274, 17786187, 18709663, 19096300, 19109251, 21489997, 22251819, 22629406, 23449277, 23469222, 25633809, 26402720, 27244893, 28061464, 29145039, 34830011, 35101055, 39265740 View all (3 more)
Carcinogenesis	Stimulate	36433941
Carcinoma	Associate	25844809, 32487254
Carcinoma Adenoid Cystic	Associate	25899808, 32964978, 33172898
Carcinoma Hepatocellular	Associate	19140237, 19447220, 24614035, 25874493, 27468214, 27579536, 28122337, 30373752, 30663411, 31363003, 32716114, 32724815, 32980960, 33824476, 33972742 View all (6 more)
Carcinoma Hepatocellular	Inhibit	27813498
Carcinoma Intraductal Noninfiltrating	Associate	30962452
Carcinoma Non Small Cell Lung	Associate	18379349, 18836087, 19037978, 19255323, 19804422, 20107422, 20124471, 20489150, 21706050, 21779788, 22052229, 22198430, 22237262, 23369236, 23507559 View all (159 more)
Carcinoma Non Small Cell Lung	Stimulate	25638566
Carcinoma Ovarian Epithelial	Associate	17595760
Carcinoma Pancreatic Ductal	Associate	21105966, 24500968, 27259358, 31311829, 31731384, 33204717, 33226369, 34957503, 7573364
Carcinoma Papillary	Associate	34801057
Carcinoma Renal Cell	Associate	10454537, 10807693, 12213728, 22198430, 23213094, 23219378, 24000165, 24023729, 25087088, 25186085, 25187556, 25564569, 26448928, 26505625, 26636767 View all (22 more)
Carcinoma Squamous Cell	Associate	19723643, 30279110, 33475256
Carcinoma Squamous Cell	Stimulate	22052229
Carcinosarcoma	Associate	31369639
Cardiovascular Diseases	Associate	33126883
CD59 Deficiency	Associate	36627004
Cerulean cataract	Stimulate	20512480
Chemical and Drug Induced Liver Injury	Associate	39362249
Cholangiocarcinoma	Associate	24563076, 26018028, 29740198, 32897609
Chordoma	Associate	20041488, 20512480, 24621885, 34127734, 34550531
Chromosome Disorders	Associate	34127734
Chronic Limb Threatening Ischemia	Associate	24947080
Clear cell metastatic renal cell carcinoma	Associate	36982721
Cognition Disorders	Stimulate	28468845
Cognition Disorders	Associate	34601245
Colorectal Neoplasms	Associate	10944610, 20032439, 20233444, 21098338, 21970370, 22936063, 23532910, 23573286, 23704319, 24205104, 24425103, 24500024, 24504536, 24714091, 25244939 View all (25 more)
Corneal Perforation	Associate	23379953
Crazy paving pattern	Associate	36810936
Cystic Fibrosis	Associate	2563631, 2563632, 2589321, 2851537, 2879438, 2879439, 2879440, 2888841, 2892400, 3026171, 3026172, 3130752, 3282234, 3467586, 3467587, 3467589 View all (1 more)
Death	Associate	19255323, 23219378, 25886066, 25965822, 27896996, 35628590
Death	Stimulate	40649874
Degloving Injuries	Associate	26988277
Dementia	Stimulate	34601245
Demyelinating Diseases	Associate	30996153
Depressive Disorder	Associate	24384148
Desmoplastic Small Round Cell Tumor	Associate	25119929
Developmental Disabilities	Associate	27086544
Diabetes Mellitus	Associate	32094377
Diabetes Mellitus Type 2	Associate	32094377
Diabetic Nephropathies	Associate	28819999
Diaphanospondylodysostosis	Associate	29910688
Diarrhea	Associate	40461383
Disease	Associate	20080979
Distal myopathy Nonaka type	Inhibit	29630524
Drug Hypersensitivity	Associate	31063779
Drug Related Side Effects and Adverse Reactions	Associate	26988277, 32240796, 36433941, 37879444
Drug Related Side Effects and Adverse Reactions	Inhibit	33108409
Edema	Associate	28644771, 32240796, 35466070, 40461383
Embryo Loss	Associate	30777867
Endometrial Neoplasms	Associate	16681770, 31992589, 32412912, 34431253, 37730563
Endometriosis	Associate	21983935, 23469222
Epidermal Cyst	Associate	39427497
Epidermolysis bullosa simplex Ogna type	Associate	28675510
Esophageal atresia with or without tracheoesophageal fistula	Associate	16320248
Esophageal Neoplasms	Associate	17062664, 32495982
Esophageal Squamous Cell Carcinoma	Associate	20534479, 22450065, 23426935, 28459198, 34217156
Esophageal Squamous Cell Carcinoma	Stimulate	34037097
Esophagitis	Associate	24742823
Essential Hypertension	Associate	19546379
Fasciculation	Associate	30777867
Fatigue	Associate	28644771
Fibrocystic Breast Disease	Associate	33382535
Fibrosarcoma	Associate	28510278, 33028644, 33850302, 36413100
Fibrosis	Inhibit	24034420
Fused Kidney	Associate	33645009
Gallbladder Neoplasms	Associate	38092180
Gastrointestinal Diseases	Associate	19548256, 36944506
Gastrointestinal Neoplasms	Associate	26375439
Glioblastoma	Associate	22203985, 22323597, 24362532, 25135958, 25754088, 25762646, 26498130, 26637806, 27172220, 29444745, 30108175, 30497369, 30760737, 31000415, 34667077, 35332262, 36972629 View all (2 more)
Glioblastoma	Stimulate	22672415
Glioma	Associate	11296484, 18077431, 23577178, 24362532, 25135958, 25762646, 25935522, 26823824, 27385209, 28965162, 29718398, 30996153, 31381204, 31554817, 32238360 View all (7 more)
Gliosarcoma	Associate	32014051
Glucosephosphate Dehydrogenase Deficiency	Associate	26366417, 34431253
Glycogen Storage Disease IIIB	Associate	34320421, 35739536
Glycosuria Renal	Associate	25087088
Gout	Associate	36627004
Hashimoto Disease	Associate	39510033
Head and Neck Neoplasms	Associate	17260003, 19639388, 26572163, 32102486
Hearing Loss	Associate	25941349
Heart Arrest	Associate	33374770, 39362249
Hemangioma	Associate	40416971
Hemangiosarcoma	Associate	25844809
Hemoglobin SC Disease	Associate	28418914
Hereditary Breast and Ovarian Cancer Syndrome	Associate	19940359, 30206415
Hereditary leiomyomatosis and renal cell cancer	Associate	23558571
HIV Infections	Associate	35730977
Hodgkin Disease	Associate	23558571, 25916750
Hyperlipoproteinemia Type II	Associate	35690785
Hypersensitivity Immediate	Inhibit	27694386
Hypertension	Associate	18701880, 19398658, 21694735
Hypertrophy Left Ventricular	Associate	18701880
Hypoxia	Stimulate	12726861
Hypoxia	Associate	22761861, 26018028
Hypoxia Brain	Associate	12726861, 26018028
Idiopathic Pulmonary Fibrosis	Associate	36211385
Inflammation	Associate	33621951, 36627004, 39766355
Influenza Human	Associate	32094377
Insulin Resistance	Associate	36627014
Intestinal Perforation	Associate	23379953
Intracranial Arterial Diseases	Associate	27693535
Kidney Diseases	Associate	24983965
Kidney Neoplasms	Associate	10491015, 23038766, 26448928, 28787086, 32083993, 37326363, 38456787
Laryngitis	Associate	29700339
Leigh syndrome French Canadian type	Associate	28608966
Leukemia	Associate	36534523
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	36195570
Leukemia Myeloid Acute	Associate	18252861, 23233446, 31638252, 34193978, 36534523
Liposarcoma Myxoid	Associate	20522586
Lung Neoplasms	Associate	18093943, 18709663, 19096300, 19117057, 19351834, 19723643, 19817696, 20736805, 21706050, 21847121, 23650389, 24200637, 24236184, 24662823, 25011627 View all (57 more)
Lymphangiectasis Intestinal	Associate	18564920
Lymphatic Diseases	Associate	16891811
Lymphatic Metastasis	Associate	12793903, 19140237, 23532910, 25364819, 28235401, 34152098
Lymphatic Metastasis	Stimulate	19940359, 35650563, 37832054
Lymphedema	Associate	18564920, 22351697
Lymphoma	Stimulate	1829952
Lymphoma	Associate	37657032
Lymphoma Large B Cell Diffuse	Associate	16189274, 23379953, 23745832, 33162801
Lymphoma Large Cell Anaplastic	Associate	30206415
Lymphoma Mantle Cell	Associate	29973234, 33336724
Lymphoma Non Hodgkin	Associate	34626238
Malignant mesenchymal tumor	Associate	33850302, 8863670
MASS syndrome	Associate	32083993
Medulloblastoma	Associate	19244381, 25163932, 26496080
Melanoma	Associate	20067553, 20520718, 22241959, 22763439, 23203808, 24372645, 24443471, 26826285, 31638339, 31877948, 37506884, 39528978, 8104462
Melanoma Cutaneous Malignant	Associate	31745173
Meningioma	Associate	38066633
Mesenchymoma	Associate	36413100
Mesothelioma	Associate	24762959, 28560410, 35319795
Mesothelioma Malignant	Associate	21774103, 25756049, 31752449
Mitochondrial Diseases	Associate	25288793
Mitochondrial Myopathies	Associate	24711008
Monoclonal Gammopathy of Undetermined Significance	Associate	23431957
Multiple Myeloma	Associate	11830493, 16189274, 18205859, 18509644, 23431957, 24326130, 24450886, 29765374
Multiple Sclerosis	Associate	30996153
Muscular Diseases	Associate	30777867
Muscular Dystrophy Duchenne	Associate	24711008
Musculoskeletal Diseases	Associate	10702398, 8863670
Myeloproliferative Disorder Chronic with Eosinophilia	Associate	24378265
Myopathies Structural Congenital	Associate	29700339
Myopia	Associate	24766640
Nasal Polyps	Stimulate	22416915
Nasal Polyps	Associate	22416915
Nasopharyngeal Carcinoma	Associate	23573286, 24722284, 25965822
Nasopharyngeal Neoplasms	Associate	18789327, 24722284
Nausea	Associate	32240796, 39362249, 40461383
Necrosis	Inhibit	33108409
Neoplasm Invasiveness	Associate	30469509, 37832054
Neoplasm Metastasis	Associate	18349821, 18709663, 19037978, 19244381, 19639388, 20080979, 20215403, 20489150, 22251819, 22533346, 22936063, 23049908, 23532910, 24297535, 24722154 View all (35 more)
Neoplasm Metastasis	Stimulate	32014051, 35650563
Neoplasms	Associate	10491015, 11027427, 11296484, 12726861, 12827550, 15319714, 16258259, 16327494, 16461907, 16891811, 17062664, 17595760, 17786187, 18053801, 18093943 View all (252 more)
Neoplasms	Stimulate	20639860, 21899661, 32083993, 34037097, 9665481
Neoplasms	Inhibit	27174587, 34431253, 35603556
Neoplasms Glandular and Epithelial	Associate	25899808
Neoplasms Radiation Induced	Associate	39265740
Neoplasms Squamous Cell	Associate	20534479, 25115387, 25348954
Neoplasms Unknown Primary	Associate	29973234
Neoplastic Syndromes Hereditary	Associate	10491015
Neuroblastoma	Associate	22266870, 31137515
Neuroma Acoustic	Associate	23354516
Neutrophil Immunodeficiency Syndrome	Associate	36627004
Nevus Epithelioid and Spindle Cell	Associate	37856952
Nevus Pigmented	Associate	30359577
Noonan like syndrome	Associate	24025166
Osteofibrous Dysplasia	Associate	26637977
Osteosarcoma	Associate	17786187, 22367914, 29334376, 30666838
Osteosarcoma	Stimulate	8863670
Ovarian Neoplasms	Associate	10491015, 21478826, 21983935, 23469222, 24447705, 24901400, 28446239, 29099290, 29920310, 31540229, 32192774, 38030594
Ovarian Neoplasms	Stimulate	32295618
Pancreatic Neoplasms	Associate	26910401, 31412643, 32537471, 32943033, 33648511, 35077391, 36364317, 37260110, 37815881, 37832054, 37881431, 9665481
Pancreatic Neoplasms	Stimulate	9665487
Papillary renal cell carcinoma sporadic	Associate	10807693, 32770124, 34029144
Paraneoplastic Syndromes Ocular	Associate	34075771
Peritonitis	Associate	25798586
Pheochromocytoma	Associate	26700204
Pleural Effusion	Associate	25638566, 25756049
Pleural Effusion Malignant	Associate	30118648
Pneumonia	Associate	36233109, 39362249
Polycystic Ovary Syndrome	Associate	36627014
Prodromal Symptoms	Stimulate	27793046
Prostatic Neoplasms	Associate	16869958, 23922103, 25087088, 26887047, 27105539, 27300295, 28510291
Prostatitis	Associate	10660600
Pulmonary Disease Chronic Obstructive	Stimulate	39766355
Pulmonary Fibrosis	Associate	27584154
Radiation Injuries	Associate	39265740
Rectal Neoplasms	Associate	28654634, 34083590
Renal cell carcinoma 1	Associate	38456787
Retinitis Pigmentosa	Associate	8317502
Rett Syndrome	Associate	24150225
Rhabdomyosarcoma	Associate	26445453, 29445192
Rufous oculocutaneous albinism	Associate	34431253
Salivary Gland Diseases	Associate	31136962
Salivary Gland Neoplasms	Associate	31502214
Sarcoma	Associate	16258259, 20512480, 27642091, 28510278, 28829837
Sarcoma Alveolar Soft Part	Associate	22605650, 29216400, 35628499
Sarcoma Clear Cell	Associate	28950372
Sarcoma Ewing	Associate	25119929
Schizophrenia	Associate	20080979, 33986383
Scleroderma Systemic	Associate	27584154
Sick Sinus Syndrome	Associate	22605616
Small Cell Lung Carcinoma	Associate	21847116, 24327519, 40649874
Soft Tissue Neoplasms	Associate	16258259
Squamous Cell Carcinoma of Head and Neck	Associate	19639388, 21899661, 23226095, 23371912, 24465403, 24722284, 25234657, 26319934, 26572163, 27244893, 27329726, 27793210, 29792310, 30488488, 31391294, 31940827, 37452322 View all (2 more)
Stiff Person Syndrome	Associate	24247044
Stomach Diseases	Associate	24742823, 33847874
Stomach Neoplasms	Associate	12086891, 16461907, 20658094, 20713453, 21097718, 21393565, 21730976, 22238368, 22262855, 22389872, 22644302, 22751462, 23327903, 23400546, 23807774 View all (30 more)
Tertiary Lymphoid Structures	Associate	28654634, 34735995
Thyroid Cancer Papillary	Associate	11752453, 17914110, 20736296, 21220347, 21537871, 24810336, 25803323, 34565758, 35389070, 40338900
Thyroid Cancer Papillary	Stimulate	39510033
Thyroid Carcinoma Anaplastic	Associate	10360640, 28489587
Thyroid Neoplasms	Associate	26044563, 26937629, 28013235, 28757314, 32737449, 32812852, 34791326, 38275291, 39684934
Triple Negative Breast Neoplasms	Associate	22788954, 25955731, 26123926, 27655711, 28371195, 30004628, 30386383
Urethritis	Associate	25087088
Urinary Bladder Neoplasms	Associate	17465217, 20421991, 28837140, 30469509, 36451132
Uterine Cervical Neoplasms	Associate	32899940, 32975231
Uveal melanoma	Associate	24551032, 30008023, 31558480
Vomiting	Associate	28644771, 32240796, 39362249
von Willebrand Disease Type 2	Associate	1912563
Weight Loss	Associate	36525397

SLTM (SAFB like transcription modulator)