Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	79811
Gene name	SAFB like transcription modulator
Gene symbol	SLTM
Synonyms (NCBI Gene)	Met
Chromosome	15
Chromosome location	15q22.1

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1401798992	G>C,T	Likely-pathogenic	Downstream transcript variant, non coding transcript variant, coding sequence variant, missense variant, genic downstream transcript variant

214

Show/Hide all (214)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021156	hsa-miR-186-5p	Sequencing	20371350
MIRT1370164	hsa-miR-101	CLIP-seq
MIRT1370165	hsa-miR-105	CLIP-seq
MIRT1370166	hsa-miR-1237	CLIP-seq
MIRT1370167	hsa-miR-1250	CLIP-seq
MIRT1370168	hsa-miR-1297	CLIP-seq
MIRT1370169	hsa-miR-1305	CLIP-seq
MIRT1370170	hsa-miR-132	CLIP-seq
MIRT1370171	hsa-miR-148a	CLIP-seq
MIRT1370172	hsa-miR-148b	CLIP-seq
MIRT1370173	hsa-miR-152	CLIP-seq
MIRT1370174	hsa-miR-194	CLIP-seq
MIRT1370175	hsa-miR-200b	CLIP-seq
MIRT1370176	hsa-miR-200c	CLIP-seq
MIRT1370177	hsa-miR-212	CLIP-seq
MIRT1370178	hsa-miR-2276	CLIP-seq
MIRT1370179	hsa-miR-26a	CLIP-seq
MIRT1370180	hsa-miR-26b	CLIP-seq
MIRT1370181	hsa-miR-3647-3p	CLIP-seq
MIRT1370182	hsa-miR-3671	CLIP-seq
MIRT1370183	hsa-miR-3692	CLIP-seq
MIRT1370184	hsa-miR-369-3p	CLIP-seq
MIRT1370185	hsa-miR-377	CLIP-seq
MIRT1370186	hsa-miR-3909	CLIP-seq
MIRT1370187	hsa-miR-4257	CLIP-seq
MIRT1370188	hsa-miR-429	CLIP-seq
MIRT1370189	hsa-miR-4436b-5p	CLIP-seq
MIRT1370190	hsa-miR-4465	CLIP-seq
MIRT1370191	hsa-miR-455-5p	CLIP-seq
MIRT1370192	hsa-miR-4700-3p	CLIP-seq
MIRT1370193	hsa-miR-4724-3p	CLIP-seq
MIRT1370194	hsa-miR-4766-3p	CLIP-seq
MIRT1370195	hsa-miR-4768-3p	CLIP-seq
MIRT1370196	hsa-miR-4772-3p	CLIP-seq
MIRT1370197	hsa-miR-495	CLIP-seq
MIRT1370198	hsa-miR-5095	CLIP-seq
MIRT1370199	hsa-miR-510	CLIP-seq
MIRT1370200	hsa-miR-512-5p	CLIP-seq
MIRT1370201	hsa-miR-513c	CLIP-seq
MIRT1370202	hsa-miR-514b-5p	CLIP-seq
MIRT1370203	hsa-miR-518d-5p	CLIP-seq
MIRT1370204	hsa-miR-519b-5p	CLIP-seq
MIRT1370205	hsa-miR-519c-5p	CLIP-seq
MIRT1370206	hsa-miR-520c-5p	CLIP-seq
MIRT1370207	hsa-miR-526a	CLIP-seq
MIRT1370208	hsa-miR-544	CLIP-seq
MIRT1370209	hsa-miR-548ad	CLIP-seq
MIRT1370210	hsa-miR-550a	CLIP-seq
MIRT1370211	hsa-miR-561	CLIP-seq
MIRT1370212	hsa-miR-562	CLIP-seq
MIRT1370213	hsa-miR-607	CLIP-seq
MIRT1370214	hsa-miR-618	CLIP-seq
MIRT1370215	hsa-miR-629	CLIP-seq
MIRT1370165	hsa-miR-105	CLIP-seq
MIRT1370167	hsa-miR-1250	CLIP-seq
MIRT1370169	hsa-miR-1305	CLIP-seq
MIRT1370216	hsa-miR-154	CLIP-seq
MIRT1370175	hsa-miR-200b	CLIP-seq
MIRT1370176	hsa-miR-200c	CLIP-seq
MIRT1370178	hsa-miR-2276	CLIP-seq
MIRT1370217	hsa-miR-2355-5p	CLIP-seq
MIRT1370218	hsa-miR-300	CLIP-seq
MIRT1370182	hsa-miR-3671	CLIP-seq
MIRT1370184	hsa-miR-369-3p	CLIP-seq
MIRT1370219	hsa-miR-381	CLIP-seq
MIRT1370220	hsa-miR-4286	CLIP-seq
MIRT1370188	hsa-miR-429	CLIP-seq
MIRT1370191	hsa-miR-455-5p	CLIP-seq
MIRT1370221	hsa-miR-4672	CLIP-seq
MIRT1370222	hsa-miR-4696	CLIP-seq
MIRT1370223	hsa-miR-4699-3p	CLIP-seq
MIRT1370192	hsa-miR-4700-3p	CLIP-seq
MIRT1370195	hsa-miR-4768-3p	CLIP-seq
MIRT1370198	hsa-miR-5095	CLIP-seq
MIRT1370199	hsa-miR-510	CLIP-seq
MIRT1370200	hsa-miR-512-5p	CLIP-seq
MIRT1370224	hsa-miR-520d-5p	CLIP-seq
MIRT1370225	hsa-miR-524-5p	CLIP-seq
MIRT1370209	hsa-miR-548ad	CLIP-seq
MIRT1370210	hsa-miR-550a	CLIP-seq
MIRT1370211	hsa-miR-561	CLIP-seq
MIRT1370213	hsa-miR-607	CLIP-seq
MIRT1370164	hsa-miR-101	CLIP-seq
MIRT1370166	hsa-miR-1237	CLIP-seq
MIRT1370168	hsa-miR-1297	CLIP-seq
MIRT1370170	hsa-miR-132	CLIP-seq
MIRT1370216	hsa-miR-154	CLIP-seq
MIRT1370174	hsa-miR-194	CLIP-seq
MIRT1370175	hsa-miR-200b	CLIP-seq
MIRT1370176	hsa-miR-200c	CLIP-seq
MIRT1370177	hsa-miR-212	CLIP-seq
MIRT1370178	hsa-miR-2276	CLIP-seq
MIRT1370179	hsa-miR-26a	CLIP-seq
MIRT1370180	hsa-miR-26b	CLIP-seq
MIRT1370181	hsa-miR-3647-3p	CLIP-seq
MIRT1370184	hsa-miR-369-3p	CLIP-seq
MIRT1370186	hsa-miR-3909	CLIP-seq
MIRT2109918	hsa-miR-3929	CLIP-seq
MIRT1370187	hsa-miR-4257	CLIP-seq
MIRT1370188	hsa-miR-429	CLIP-seq
MIRT2109919	hsa-miR-4325	CLIP-seq
MIRT2109920	hsa-miR-4419b	CLIP-seq
MIRT1370190	hsa-miR-4465	CLIP-seq
MIRT2109921	hsa-miR-4478	CLIP-seq
MIRT1370221	hsa-miR-4672	CLIP-seq
MIRT2109922	hsa-miR-4680-5p	CLIP-seq
MIRT1370193	hsa-miR-4724-3p	CLIP-seq
MIRT1370196	hsa-miR-4772-3p	CLIP-seq
MIRT1370199	hsa-miR-510	CLIP-seq
MIRT1370200	hsa-miR-512-5p	CLIP-seq
MIRT1370201	hsa-miR-513c	CLIP-seq
MIRT1370202	hsa-miR-514b-5p	CLIP-seq
MIRT1370208	hsa-miR-544	CLIP-seq
MIRT1370211	hsa-miR-561	CLIP-seq
MIRT1370212	hsa-miR-562	CLIP-seq
MIRT1370164	hsa-miR-101	CLIP-seq
MIRT2333265	hsa-miR-106a	CLIP-seq
MIRT2333266	hsa-miR-106b	CLIP-seq
MIRT1370166	hsa-miR-1237	CLIP-seq
MIRT1370168	hsa-miR-1297	CLIP-seq
MIRT1370170	hsa-miR-132	CLIP-seq
MIRT2333267	hsa-miR-17	CLIP-seq
MIRT1370174	hsa-miR-194	CLIP-seq
MIRT2333268	hsa-miR-20a	CLIP-seq
MIRT2333269	hsa-miR-20b	CLIP-seq
MIRT1370177	hsa-miR-212	CLIP-seq
MIRT1370178	hsa-miR-2276	CLIP-seq
MIRT1370179	hsa-miR-26a	CLIP-seq
MIRT1370180	hsa-miR-26b	CLIP-seq
MIRT1370185	hsa-miR-377	CLIP-seq
MIRT1370186	hsa-miR-3909	CLIP-seq
MIRT1370187	hsa-miR-4257	CLIP-seq
MIRT2109919	hsa-miR-4325	CLIP-seq
MIRT1370190	hsa-miR-4465	CLIP-seq
MIRT1370221	hsa-miR-4672	CLIP-seq
MIRT1370193	hsa-miR-4724-3p	CLIP-seq
MIRT1370196	hsa-miR-4772-3p	CLIP-seq
MIRT1370201	hsa-miR-513c	CLIP-seq
MIRT1370202	hsa-miR-514b-5p	CLIP-seq
MIRT2333270	hsa-miR-519a	CLIP-seq
MIRT2333271	hsa-miR-519b-3p	CLIP-seq
MIRT2333272	hsa-miR-519c-3p	CLIP-seq
MIRT2333273	hsa-miR-519d	CLIP-seq
MIRT1370208	hsa-miR-544	CLIP-seq
MIRT1370209	hsa-miR-548ad	CLIP-seq
MIRT2333274	hsa-miR-548n	CLIP-seq
MIRT2333275	hsa-miR-548t	CLIP-seq
MIRT1370212	hsa-miR-562	CLIP-seq
MIRT2333276	hsa-miR-93	CLIP-seq
MIRT1370192	hsa-miR-4700-3p	CLIP-seq
MIRT1370195	hsa-miR-4768-3p	CLIP-seq
MIRT1370198	hsa-miR-5095	CLIP-seq
MIRT1370211	hsa-miR-561	CLIP-seq
MIRT2440560	hsa-miR-140-3p	CLIP-seq
MIRT2440561	hsa-miR-610	CLIP-seq
MIRT1370165	hsa-miR-105	CLIP-seq
MIRT1370167	hsa-miR-1250	CLIP-seq
MIRT1370169	hsa-miR-1305	CLIP-seq
MIRT2627529	hsa-miR-1323	CLIP-seq
MIRT2440560	hsa-miR-140-3p	CLIP-seq
MIRT1370178	hsa-miR-2276	CLIP-seq
MIRT1370182	hsa-miR-3671	CLIP-seq
MIRT1370185	hsa-miR-377	CLIP-seq
MIRT2627530	hsa-miR-4461	CLIP-seq
MIRT1370191	hsa-miR-455-5p	CLIP-seq
MIRT1370222	hsa-miR-4696	CLIP-seq
MIRT2627531	hsa-miR-4731-3p	CLIP-seq
MIRT2627532	hsa-miR-4801	CLIP-seq
MIRT2627533	hsa-miR-515-5p	CLIP-seq
MIRT2627534	hsa-miR-539	CLIP-seq
MIRT1370209	hsa-miR-548ad	CLIP-seq
MIRT2333274	hsa-miR-548n	CLIP-seq
MIRT2627535	hsa-miR-548o	CLIP-seq
MIRT2333275	hsa-miR-548t	CLIP-seq
MIRT1370210	hsa-miR-550a	CLIP-seq
MIRT2627536	hsa-miR-580	CLIP-seq
MIRT2627537	hsa-miR-606	CLIP-seq
MIRT1370213	hsa-miR-607	CLIP-seq
MIRT2440561	hsa-miR-610	CLIP-seq
MIRT2627538	hsa-miR-942	CLIP-seq
MIRT1370165	hsa-miR-105	CLIP-seq
MIRT1370167	hsa-miR-1250	CLIP-seq
MIRT1370169	hsa-miR-1305	CLIP-seq
MIRT2627529	hsa-miR-1323	CLIP-seq
MIRT2440560	hsa-miR-140-3p	CLIP-seq
MIRT1370182	hsa-miR-3671	CLIP-seq
MIRT1370185	hsa-miR-377	CLIP-seq
MIRT2691346	hsa-miR-3926	CLIP-seq
MIRT1370187	hsa-miR-4257	CLIP-seq
MIRT2691347	hsa-miR-433	CLIP-seq
MIRT2627530	hsa-miR-4461	CLIP-seq
MIRT1370191	hsa-miR-455-5p	CLIP-seq
MIRT2109922	hsa-miR-4680-5p	CLIP-seq
MIRT2627531	hsa-miR-4731-3p	CLIP-seq
MIRT2627532	hsa-miR-4801	CLIP-seq
MIRT2691348	hsa-miR-494	CLIP-seq
MIRT1370197	hsa-miR-495	CLIP-seq
MIRT2691349	hsa-miR-513a-3p	CLIP-seq
MIRT1370201	hsa-miR-513c	CLIP-seq
MIRT1370202	hsa-miR-514b-5p	CLIP-seq
MIRT2627533	hsa-miR-515-5p	CLIP-seq
MIRT2627534	hsa-miR-539	CLIP-seq
MIRT1370209	hsa-miR-548ad	CLIP-seq
MIRT2333274	hsa-miR-548n	CLIP-seq
MIRT2627535	hsa-miR-548o	CLIP-seq
MIRT2691350	hsa-miR-548s	CLIP-seq
MIRT2333275	hsa-miR-548t	CLIP-seq
MIRT1370210	hsa-miR-550a	CLIP-seq
MIRT2627536	hsa-miR-580	CLIP-seq
MIRT2627537	hsa-miR-606	CLIP-seq
MIRT1370213	hsa-miR-607	CLIP-seq
MIRT2440561	hsa-miR-610	CLIP-seq
MIRT2691351	hsa-miR-659	CLIP-seq
MIRT2627538	hsa-miR-942	CLIP-seq

Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006915	Process	Apoptotic process	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0043565	Function	Sequence-specific DNA binding	IBA
GO:0050684	Process	Regulation of mRNA processing	IBA

MIM	HGNC	e!Ensembl
620992	20709	ENSG00000137776

Q9NWH9

Protein name

SAFB-like transcription modulator (Modulator of estrogen-induced transcription)

Protein function

When overexpressed, acts as a general inhibitor of transcription that eventually leads to apoptosis.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02037	SAP	22 → 56	SAP domain	Family
PF00076	RRM_1	386 → 456	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain

Sequence

MAAATGAVAASAASGQAEGKKITDLRVIDLKSELKRRNLDITGVKTVLISRLKQAIEEEG
GDPDNIELTVSTDTPNKKPTKGKGKKHEADELSGDASVEDDAFIKDCELENQEAHEQDGN
DELKDSEEFGENEEENVHSKELLSAEENKRAHELIEAEGIEDIEKEDIESQEIEAQEGED
DTFLTAQDGEEEENEKDIAGSGDGTQEVSKPLPSEGSLAEADHTAHEEMEAHTTVKEAED
DNISVTIQAEDAITLDFDGDDLLETGKNVKITDSEASKPKDGQDAIAQSPEKESKDYEMN
ANHKDGKKEDCVKGDPVEKEARESSKKAESGDKEKDTLKKGPSSTGASGQAKSSSKESKD
SKTSSKDDKGSTSSTSGSSGSSTKNIWVSGLSSNTKAADLKNLFGKYGKVLSAKVVTNAR
SPGAKCYGIVTMSSSTEVSRCIAHLHRTELHGQLISVEKVKGDPSKKEMKKENDEKSSSR
SSGDKKNTSDRSSKTQASVKKEEKRSSEKSEKKESKDTKKIEGKDEKNDNGASGQTSESI
KKSEEKKRISSKSPGHMVILDQTKGDHCRPSRRGRYEKIHGRSKEKERASLDKKRDKDYR
RKEILPFEKMKEQRLREHLVRFERLRRAMELRRRREIAERERRERERIRIIREREERERL
QRERERLEIERQKLERERMERERLERERIRIEQERRKEAERIAREREELRRQQQQLRYEQ
EKRNSLKRPRDVDHRRDDPYWSENKKLSLDTDARFGHGSDYSRQQNRFNDFDHRERGRFP
ESSAVQSSSFERRDRFVGQSEGKKARPTARREDPSFERYPKNFSDSRRNEPPPPRNELRE
SDRREVRGERDERRTVIIHDRPDITHPRHPREAGPNPSRPTSWKSEGSMSTDKRETRVER
PERSGREVSGHSVRGAPPGNRSSASGYGSREGDRGVITDRGGGSQHYPEERHVVERHGRD
TSGPRKEWHGPPSQGPSYHDTRRMGDGRAGAGMITQHSSNASPINRIVQISGNSMPRGSG
SGFKPFKGGPPRRF

Sequence length

1034

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Jeune thoracic dystrophy	Likely pathogenic	rs1401798992	RCV000755166	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASPERGER SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (257)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Abnormalities Drug Induced	Associate	25087088	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Associate	15720819, 17062664, 18349821, 18379349, 19096300, 22042947, 22052229, 22198430, 22450065, 23449277, 25886066, 26183759, 26315110, 27080983, 27300295 View all (17 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Clear Cell	Associate	21478826, 21983935	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Mucinous	Associate	32840168	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Associate	16327494	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Associate	18093943, 19096300, 20150826, 22975805, 25079552, 25886066, 25922291, 25971939, 26066407, 26098749, 26416301, 26791794, 26845116, 27060149, 27151654 View all (39 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Stimulate	19817696	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Associate	34801057	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma Pleomorphic	Associate	33838468	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Associate	28141798	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Associate	25087088, 35462410	★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic Fungal Sinusitis	Stimulate	22416915	★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic Fungal Sinusitis	Associate	22416915	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Stimulate	18786162	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Associate	20593467, 24384148	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Associate	24939847	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneuploidy	Associate	34303217, 34677235	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Associate	24247044	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia of Lacrimal and Salivary Glands	Associate	25899808	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthrogryposis	Associate	30777867	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Associate	11296484, 22672415, 30996153, 39357189	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asymptomatic Diseases	Associate	36810936	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Associate	36341343	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Associate	19360663, 19548256, 22958829, 23097380, 24150225	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Inhibit	21832174	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Associate	17053076, 19002214, 19548256, 20080979, 21832174, 22110649, 22558359, 22833194, 22958829, 23097380, 27086544, 28507316	★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Associate	15720819	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bile Duct Diseases	Associate	7573364	★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Associate	32447492, 37326363	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Associate	23431957, 28334277	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Associate	25418580	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Associate	20489150, 27693535, 33335011, 34812554, 36749292	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	12475979, 12673709, 12793903, 17260003, 18160707, 18381931, 18499206, 18564920, 22105362, 22379025, 22850551, 22869872, 23049908, 23063927, 23825050 View all (17 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Stimulate	30004628	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Inhibit	33108409	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms Male	Associate	23308200	★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis Cutis	Associate	27894094, 30463996, 32820577, 8104462	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	16189274, 17786187, 18709663, 19096300, 19109251, 21489997, 22251819, 22629406, 23449277, 23469222, 25633809, 26402720, 27244893, 28061464, 29145039, 34830011, 35101055, 39265740 View all (3 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Stimulate	36433941	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Associate	25844809, 32487254	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Associate	25899808, 32964978, 33172898	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	19140237, 19447220, 24614035, 25874493, 27468214, 27579536, 28122337, 30373752, 30663411, 31363003, 32716114, 32724815, 32980960, 33824476, 33972742 View all (6 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Inhibit	27813498	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Associate	30962452	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	18379349, 18836087, 19037978, 19255323, 19804422, 20107422, 20124471, 20489150, 21706050, 21779788, 22052229, 22198430, 22237262, 23369236, 23507559 View all (159 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Stimulate	25638566	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Associate	17595760	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Associate	21105966, 24500968, 27259358, 31311829, 31731384, 33204717, 33226369, 34957503, 7573364	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Papillary	Associate	34801057	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	10454537, 10807693, 12213728, 22198430, 23213094, 23219378, 24000165, 24023729, 25087088, 25186085, 25187556, 25564569, 26448928, 26505625, 26636767 View all (22 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	19723643, 30279110, 33475256	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Stimulate	22052229	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Associate	31369639	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Associate	33126883	★★★★★ ★☆☆☆☆ Found in Text Mining only
CD59 Deficiency	Associate	36627004	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerulean cataract	Stimulate	20512480	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chemical and Drug Induced Liver Injury	Associate	39362249	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Associate	24563076, 26018028, 29740198, 32897609	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chordoma	Associate	20041488, 20512480, 24621885, 34127734, 34550531	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosome Disorders	Associate	34127734	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Limb Threatening Ischemia	Associate	24947080	★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear cell metastatic renal cell carcinoma	Associate	36982721	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Stimulate	28468845	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Associate	34601245	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	10944610, 20032439, 20233444, 21098338, 21970370, 22936063, 23532910, 23573286, 23704319, 24205104, 24425103, 24500024, 24504536, 24714091, 25244939 View all (25 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Perforation	Associate	23379953	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crazy paving pattern	Associate	36810936	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Associate	2563631, 2563632, 2589321, 2851537, 2879438, 2879439, 2879440, 2888841, 2892400, 3026171, 3026172, 3130752, 3282234, 3467586, 3467587, 3467589 View all (1 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Death	Associate	19255323, 23219378, 25886066, 25965822, 27896996, 35628590	★★★★★ ★☆☆☆☆ Found in Text Mining only
Death	Stimulate	40649874	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degloving Injuries	Associate	26988277	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Stimulate	34601245	★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Associate	30996153	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Associate	24384148	★★★★★ ★☆☆☆☆ Found in Text Mining only
Desmoplastic Small Round Cell Tumor	Associate	25119929	★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Associate	27086544	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Associate	32094377	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Associate	32094377	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Associate	28819999	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diaphanospondylodysostosis	Associate	29910688	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diarrhea	Associate	40461383	★★★★★ ★☆☆☆☆ Found in Text Mining only
Disease	Associate	20080979	★★★★★ ★☆☆☆☆ Found in Text Mining only
Distal myopathy Nonaka type	Inhibit	29630524	★★★★★ ★☆☆☆☆ Found in Text Mining only
Drug Hypersensitivity	Associate	31063779	★★★★★ ★☆☆☆☆ Found in Text Mining only
Drug Related Side Effects and Adverse Reactions	Associate	26988277, 32240796, 36433941, 37879444	★★★★★ ★☆☆☆☆ Found in Text Mining only
Drug Related Side Effects and Adverse Reactions	Inhibit	33108409	★★★★★ ★☆☆☆☆ Found in Text Mining only
Edema	Associate	28644771, 32240796, 35466070, 40461383	★★★★★ ★☆☆☆☆ Found in Text Mining only
Embryo Loss	Associate	30777867	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Associate	16681770, 31992589, 32412912, 34431253, 37730563	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Associate	21983935, 23469222	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermal Cyst	Associate	39427497	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermolysis bullosa simplex Ogna type	Associate	28675510	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal atresia with or without tracheoesophageal fistula	Associate	16320248	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Associate	17062664, 32495982	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Associate	20534479, 22450065, 23426935, 28459198, 34217156	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Stimulate	34037097	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophagitis	Associate	24742823	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Associate	19546379	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fasciculation	Associate	30777867	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatigue	Associate	28644771	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrocystic Breast Disease	Associate	33382535	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Associate	28510278, 33028644, 33850302, 36413100	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis	Inhibit	24034420	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fused Kidney	Associate	33645009	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Associate	38092180	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Associate	19548256, 36944506	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Associate	26375439	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	22203985, 22323597, 24362532, 25135958, 25754088, 25762646, 26498130, 26637806, 27172220, 29444745, 30108175, 30497369, 30760737, 31000415, 34667077, 35332262, 36972629 View all (2 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Stimulate	22672415	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Associate	11296484, 18077431, 23577178, 24362532, 25135958, 25762646, 25935522, 26823824, 27385209, 28965162, 29718398, 30996153, 31381204, 31554817, 32238360 View all (7 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gliosarcoma	Associate	32014051	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucosephosphate Dehydrogenase Deficiency	Associate	26366417, 34431253	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease IIIB	Associate	34320421, 35739536	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Associate	25087088	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Associate	36627004	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Associate	39510033	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Associate	17260003, 19639388, 26572163, 32102486	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss	Associate	25941349	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Arrest	Associate	33374770, 39362249	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioma	Associate	40416971	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Associate	25844809	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemoglobin SC Disease	Associate	28418914	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Associate	19940359, 30206415	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary leiomyomatosis and renal cell cancer	Associate	23558571	★★★★★ ★☆☆☆☆ Found in Text Mining only
HIV Infections	Associate	35730977	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Associate	23558571, 25916750	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Associate	35690785	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Inhibit	27694386	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Associate	18701880, 19398658, 21694735	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Associate	18701880	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Stimulate	12726861	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Associate	22761861, 26018028	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia Brain	Associate	12726861, 26018028	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Associate	36211385	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	33621951, 36627004, 39766355	★★★★★ ★☆☆☆☆ Found in Text Mining only
Influenza Human	Associate	32094377	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Associate	36627014	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Perforation	Associate	23379953	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Arterial Diseases	Associate	27693535	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Associate	24983965	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Associate	10491015, 23038766, 26448928, 28787086, 32083993, 37326363, 38456787	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngitis	Associate	29700339	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leigh syndrome French Canadian type	Associate	28608966	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Associate	36534523	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	36195570	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	18252861, 23233446, 31638252, 34193978, 36534523	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma Myxoid	Associate	20522586	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	18093943, 18709663, 19096300, 19117057, 19351834, 19723643, 19817696, 20736805, 21706050, 21847121, 23650389, 24200637, 24236184, 24662823, 25011627 View all (57 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphangiectasis Intestinal	Associate	18564920	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Diseases	Associate	16891811	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Associate	12793903, 19140237, 23532910, 25364819, 28235401, 34152098	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Stimulate	19940359, 35650563, 37832054	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphedema	Associate	18564920, 22351697	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Stimulate	1829952	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Associate	37657032	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Large B Cell Diffuse	Associate	16189274, 23379953, 23745832, 33162801	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Large Cell Anaplastic	Associate	30206415	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Mantle Cell	Associate	29973234, 33336724	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Non Hodgkin	Associate	34626238	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesenchymal tumor	Associate	33850302, 8863670	★★★★★ ★☆☆☆☆ Found in Text Mining only
MASS syndrome	Associate	32083993	★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Associate	19244381, 25163932, 26496080	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	20067553, 20520718, 22241959, 22763439, 23203808, 24372645, 24443471, 26826285, 31638339, 31877948, 37506884, 39528978, 8104462	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Associate	31745173	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Associate	38066633	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesenchymoma	Associate	36413100	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Associate	24762959, 28560410, 35319795	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Associate	21774103, 25756049, 31752449	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Associate	25288793	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Myopathies	Associate	24711008	★★★★★ ★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Associate	23431957	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Associate	11830493, 16189274, 18205859, 18509644, 23431957, 24326130, 24450886, 29765374	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Associate	30996153	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Diseases	Associate	30777867	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Associate	24711008	★★★★★ ★☆☆☆☆ Found in Text Mining only
Musculoskeletal Diseases	Associate	10702398, 8863670	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorder Chronic with Eosinophilia	Associate	24378265	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathies Structural Congenital	Associate	29700339	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Associate	24766640	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Stimulate	22416915	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Associate	22416915	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Associate	23573286, 24722284, 25965822	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Associate	18789327, 24722284	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nausea	Associate	32240796, 39362249, 40461383	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Inhibit	33108409	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Invasiveness	Associate	30469509, 37832054	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	18349821, 18709663, 19037978, 19244381, 19639388, 20080979, 20215403, 20489150, 22251819, 22533346, 22936063, 23049908, 23532910, 24297535, 24722154 View all (35 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Stimulate	32014051, 35650563	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	10491015, 11027427, 11296484, 12726861, 12827550, 15319714, 16258259, 16327494, 16461907, 16891811, 17062664, 17595760, 17786187, 18053801, 18093943 View all (252 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	20639860, 21899661, 32083993, 34037097, 9665481	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	27174587, 34431253, 35603556	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms Glandular and Epithelial	Associate	25899808	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms Radiation Induced	Associate	39265740	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms Squamous Cell	Associate	20534479, 25115387, 25348954	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms Unknown Primary	Associate	29973234	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplastic Syndromes Hereditary	Associate	10491015	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Associate	22266870, 31137515	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroma Acoustic	Associate	23354516	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutrophil Immunodeficiency Syndrome	Associate	36627004	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nevus Epithelioid and Spindle Cell	Associate	37856952	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nevus Pigmented	Associate	30359577	★★★★★ ★☆☆☆☆ Found in Text Mining only
Noonan like syndrome	Associate	24025166	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteofibrous Dysplasia	Associate	26637977	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Associate	17786187, 22367914, 29334376, 30666838	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Stimulate	8863670	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	10491015, 21478826, 21983935, 23469222, 24447705, 24901400, 28446239, 29099290, 29920310, 31540229, 32192774, 38030594	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Stimulate	32295618	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	26910401, 31412643, 32537471, 32943033, 33648511, 35077391, 36364317, 37260110, 37815881, 37832054, 37881431, 9665481	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Stimulate	9665487	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary renal cell carcinoma sporadic	Associate	10807693, 32770124, 34029144	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraneoplastic Syndromes Ocular	Associate	34075771	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Associate	25798586	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Associate	26700204	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleural Effusion	Associate	25638566, 25756049	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleural Effusion Malignant	Associate	30118648	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pneumonia	Associate	36233109, 39362249	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Associate	36627014	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prodromal Symptoms	Stimulate	27793046	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	16869958, 23922103, 25087088, 26887047, 27105539, 27300295, 28510291	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatitis	Associate	10660600	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Stimulate	39766355	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Associate	27584154	★★★★★ ★☆☆☆☆ Found in Text Mining only
Radiation Injuries	Associate	39265740	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Associate	28654634, 34083590	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal cell carcinoma 1	Associate	38456787	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Associate	8317502	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Associate	24150225	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Associate	26445453, 29445192	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Associate	34431253	★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Diseases	Associate	31136962	★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Associate	31502214	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Associate	16258259, 20512480, 27642091, 28510278, 28829837	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Alveolar Soft Part	Associate	22605650, 29216400, 35628499	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Clear Cell	Associate	28950372	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Associate	25119929	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Associate	20080979, 33986383	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma Systemic	Associate	27584154	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Associate	22605616	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Associate	21847116, 24327519, 40649874	★★★★★ ★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Associate	16258259	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	19639388, 21899661, 23226095, 23371912, 24465403, 24722284, 25234657, 26319934, 26572163, 27244893, 27329726, 27793210, 29792310, 30488488, 31391294, 31940827, 37452322 View all (2 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stiff Person Syndrome	Associate	24247044	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Associate	24742823, 33847874	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	12086891, 16461907, 20658094, 20713453, 21097718, 21393565, 21730976, 22238368, 22262855, 22389872, 22644302, 22751462, 23327903, 23400546, 23807774 View all (30 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tertiary Lymphoid Structures	Associate	28654634, 34735995	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Associate	11752453, 17914110, 20736296, 21220347, 21537871, 24810336, 25803323, 34565758, 35389070, 40338900	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Stimulate	39510033	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Associate	10360640, 28489587	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Associate	26044563, 26937629, 28013235, 28757314, 32737449, 32812852, 34791326, 38275291, 39684934	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Associate	22788954, 25955731, 26123926, 27655711, 28371195, 30004628, 30386383	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urethritis	Associate	25087088	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	17465217, 20421991, 28837140, 30469509, 36451132	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Associate	32899940, 32975231	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Associate	24551032, 30008023, 31558480	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vomiting	Associate	28644771, 32240796, 39362249	★★★★★ ★☆☆☆☆ Found in Text Mining only
von Willebrand Disease Type 2	Associate	1912563	★★★★★ ★☆☆☆☆ Found in Text Mining only
Weight Loss	Associate	36525397	★★★★★ ★☆☆☆☆ Found in Text Mining only

SLTM (SAFB like transcription modulator)