Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
79798
Gene name Gene Name - the full gene name approved by the HGNC.
Armadillo repeat containing 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ARMC5
Synonyms (NCBI Gene) Gene synonyms aliases
AIMAH2
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16p11.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the ARM (armadillo/beta-catenin-like repeat) superfamily. The ARM repeat is a tandemly repeated sequence motif with approximately 40 amino acid long. This repeat is implicated in mediating protein-protein interactions. The en
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs369721476 C>T Pathogenic Stop gained, coding sequence variant
rs587777659 C>T Pathogenic Missense variant, 3 prime UTR variant, coding sequence variant
rs587777660 C>T Pathogenic Stop gained, coding sequence variant
rs587777661 T>C Pathogenic Missense variant, coding sequence variant
rs587777662 C>T Pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT799148 hsa-miR-1915 CLIP-seq
MIRT799149 hsa-miR-3127-3p CLIP-seq
MIRT799150 hsa-miR-3189-3p CLIP-seq
MIRT799151 hsa-miR-3191 CLIP-seq
MIRT799152 hsa-miR-4726-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin IDA 39667934
GO:0001701 Process In utero embryonic development IEA
GO:0001707 Process Mesoderm formation IEA
GO:0005515 Function Protein binding IPI 28169274, 32296183
GO:0005634 Component Nucleus IDA 35687106, 38225631
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
615549 25781 ENSG00000140691
Protein
UniProt ID Q96C12
Protein name Armadillo repeat-containing protein 5
Protein function Substrate-recognition component of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex that terminates RNA polymerase II (Pol II) transcription in the promoter-proximal region of genes (PubMed:39504960, PubMed:39667934). The BCR(ARMC5) complex pro
Family and domains
Sequence
MAAAKPTLTDSLSFCLAQLAAAAGEALGGEKDPATNETPLSRALLALRTRHIKAAGGIER
FRARGGLRPLLALLRRAAAAGSAPSQAGPGSAPSSAASGASSPAPASGPAPSAVSSSSPT
PPVRLRKTLDLALSILADCCTEGACRTEVRRLGGILPLVTILQCMKTDSIQNRTARALGN
LAMEPESCGDIHCAGAVPLLVESLTACQDSQCLQSVVRALRNLADSPQHRLALAQQGAVR
PLAELLATAPDAALTLALVRALLELSRGCSRACAEQLSLGGGLGPLVSLASHPKRAVREG
TILILANLCAQGLIRPALGNAGGVEVLVDELRQRRDPNGASPTSQQPLVRAVCLLCREAI
NRARLRDAGGLDLLMGLLRDPRASAWHPRIVAALVGFLYDTGALGRLQALGLVPLLAGQL
CGEAGEEEEEGREAASWDFPEERTPERAQGGSFRSLRSWLISEGYATGPDDISPDWSPEQ
CPPEPMEPASPAPTPTSLRAPRTQRTPGRSPAAAIEEPWGREGPALLLLSRFSQAPDPSG
ALVTGPALYGLLTYVTGAPGPPSPRALRILSRLTCNPACLEAFVRSYGAALLRAWLVLGV
APDDWPAPRARPTLHSRHRELGERLLQNLTVQAESPFGVGALTHLLLSGSPEDRVACALT
LPFICRKPSLWRRLLLEQGGLRLLLAALTRPAPHPLFLFFAADSLSCLQDLVSPTVSPAV
PQAVPMDLDSPSPCLYEPLLGPAPVPAPDLHFLLDSGLQLPAQRAASATASPFFRALLSG
SFAEAQMDLVPLRGLSPGAAWPVLHHLHGCRGCGAALGPVPPPGQPLLGSEAEEALEAAG
RFLLPGLEEELEEAVGRIHLGPQGGPESVGEVFRLGRPRLAAHCARWTLGSEQCPRKRGL
ALVGLVEAAGEEAGPLTEALLAVVMGIELGARVPA
Sequence length 935
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Cushing syndrome  
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Acth-independent macronodular adrenal hyperplasia acth-independent macronodular adrenal hyperplasia 2 rs1596605496, rs369721476, rs587777659, rs587777660, rs587777661, rs951869246, rs587777663 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Cushing`s Syndrome Cushing syndrome due to macronodular adrenal hyperplasia N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acth Independent Macronodular Adrenal Hyperplasia Associate 24283224, 24601692, 25279498, 25822102, 25853793, 26162405, 27568465, 29279458, 29343284, 29370219, 29587644, 31014964, 32117062, 32267363, 32638579
View all (10 more)
ACTH Syndrome Ectopic Associate 32267363
Adrenal Cortex Neoplasms Associate 26162405
Adrenal Gland Diseases Associate 32901291
Adrenal Gland Neoplasms Inhibit 32436940
Adrenal Gland Neoplasms Associate 32901291
Adrenal incidentaloma Associate 32117062, 37625448
Adrenocortical Adenoma Associate 33564960
Adrenocortical Carcinoma Associate 33564960
Carcinogenesis Associate 33544460