Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
79753
Gene name Gene Name - the full gene name approved by the HGNC.
Smad nuclear interacting protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SNIP1
Synonyms (NCBI Gene) Gene synonyms aliases
NEDHCS, PML1, PMRED
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p34.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that contains a coiled-coil motif and C-terminal forkhead-associated (FHA) domain. The encoded protein functions as a transcriptional coactivator that increases c-Myc activity and inhibits transforming growth factor beta (TGF-b
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs202020647 G>A Pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT699110 hsa-miR-4740-3p HITS-CLIP 23313552
MIRT699109 hsa-miR-4722-3p HITS-CLIP 23313552
MIRT699108 hsa-miR-6727-3p HITS-CLIP 23313552
MIRT699107 hsa-miR-6747-3p HITS-CLIP 23313552
MIRT699106 hsa-miR-3653-5p HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000398 Process MRNA splicing, via spliceosome IDA 29360106
GO:0000398 Process MRNA splicing, via spliceosome NAS 31744343
GO:0003723 Function RNA binding HDA 22658674
GO:0003729 Function MRNA binding IBA
GO:0005515 Function Protein binding IPI 17157259, 18794151, 21516116, 22365833, 25416956, 28514442, 31515488, 32296183, 32707033, 33961781, 38309408
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608241 30587 ENSG00000163877
Protein
UniProt ID Q8TAD8
Protein name Smad nuclear-interacting protein 1 (FHA domain-containing protein SNIP1)
Protein function Required for pre-mRNA splicing as component of the spliceosome (PubMed:29360106). As a component of the minor spliceosome, involved in the splicing of U12-type introns in pre-mRNAs (Probable). Down-regulates NF-kappa-B signaling by competing wit
PDB 5Z56 , 5Z57 , 5Z58 , 6FF7 , 7ABG , 7ABH , 7ABI , 7DVQ , 8I0P , 8I0R
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00498 FHA 281 361 FHA domain Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous, with highest expression in heart and skeletal muscle. {ECO:0000269|PubMed:10887155}.
Sequence
MKAVKSERERGSRRRHRDGDVVLPAGVVVKQERLSPEVAPPAHRRPDHSGGSPSPPTSEP
ARSGHRGNRARGVSRSPPKKKNKASGRRSKSPRSKRNRSPHHSTVKVKQEREDHPRRGRE
DRQHREPSEQEHRRARNSDRDRHRGHSHQRRTSNERPGSGQGQGRDRDTQNLQAQEEERE
FYNARRREHRQRNDVGGGGSESQELVPRPGGNNKEKEVPAKEKPSFELSGALLEDTNTFR
GVVIKYSEPPEARIPKKRWRLYPFKNDEVLPVMYIHRQSAYLLGRHRRIADIPIDHPSCS
KQHAVFQYRLVEYTRADGTVGRRVKPYIIDLGSGNGTFLNNKRIEPQRYYELKEKDVLKF
G
FSSREYVLLHESSDTSEIDRKDDEDEEEEEEVSDS
Sequence length 396
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
PSYCHOMOTOR RETARDATION, EPILEPSY, AND CRANIOFACIAL DYSMORPHISM psychomotor retardation, epilepsy, and craniofacial dysmorphism N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 35589867
Carcinogenesis Associate 17157259
Carcinoma Non Small Cell Lung Associate 17157259, 36597175
Developmental Disabilities Associate 34570759
Enteritis Associate 34151668
Genetic Diseases Inborn Associate 34570759
Inflammatory Bowel Diseases Associate 34151668
Intellectual Disability Associate 34570759
Kifafa seizure disorder Associate 34570759
Lung Neoplasms Associate 36597175