Gene Gene information from NCBI Gene database.
Entrez ID 79753
Gene name Smad nuclear interacting protein 1
Gene symbol SNIP1
Synonyms (NCBI Gene)
NEDHCSPML1PMRED
Chromosome 1
Chromosome location 1p34.3
Summary This gene encodes a protein that contains a coiled-coil motif and C-terminal forkhead-associated (FHA) domain. The encoded protein functions as a transcriptional coactivator that increases c-Myc activity and inhibits transforming growth factor beta (TGF-b
SNPs SNP information provided by dbSNP.
1
SNP ID Visualize variation Clinical significance Consequence
rs202020647 G>A Pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
247
miRTarBase ID miRNA Experiments Reference
MIRT699110 hsa-miR-4740-3p HITS-CLIP 23313552
MIRT699109 hsa-miR-4722-3p HITS-CLIP 23313552
MIRT699108 hsa-miR-6727-3p HITS-CLIP 23313552
MIRT699107 hsa-miR-6747-3p HITS-CLIP 23313552
MIRT699106 hsa-miR-3653-5p HITS-CLIP 23313552
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
26
GO ID Ontology Definition Evidence Reference
GO:0000398 Process MRNA splicing, via spliceosome IDA 29360106
GO:0000398 Process MRNA splicing, via spliceosome NAS 31744343
GO:0003723 Function RNA binding HDA 22658674
GO:0003729 Function MRNA binding IBA
GO:0005515 Function Protein binding IPI 17157259, 18794151, 21516116, 22365833, 25416956, 28514442, 31515488, 32296183, 32707033, 33961781, 38309408
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
608241 30587 ENSG00000163877
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8TAD8
Protein name Smad nuclear-interacting protein 1 (FHA domain-containing protein SNIP1)
Protein function Required for pre-mRNA splicing as component of the spliceosome (PubMed:29360106). As a component of the minor spliceosome, involved in the splicing of U12-type introns in pre-mRNAs (Probable). Down-regulates NF-kappa-B signaling by competing wit
PDB 5Z56 , 5Z57 , 5Z58 , 6FF7 , 7ABG , 7ABH , 7ABI , 7DVQ , 8I0P , 8I0R
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00498 FHA 281 361 FHA domain Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous, with highest expression in heart and skeletal muscle. {ECO:0000269|PubMed:10887155}.
Sequence
MKAVKSERERGSRRRHRDGDVVLPAGVVVKQERLSPEVAPPAHRRPDHSGGSPSPPTSEP
ARSGHRGNRARGVSRSPPKKKNKASGRRSKSPRSKRNRSPHHSTVKVKQEREDHPRRGRE
DRQHREPSEQEHRRARNSDRDRHRGHSHQRRTSNERPGSGQGQGRDRDTQNLQAQEEERE
FYNARRREHRQRNDVGGGGSESQELVPRPGGNNKEKEVPAKEKPSFELSGALLEDTNTFR
GVVIKYSEPPEARIPKKRWRLYPFKNDEVLPVMYIHRQSAYLLGRHRRIADIPIDHPSCS
KQHAVFQYRLVEYTRADGTVGRRVKPYIIDLGSGNGTFLNNKRIEPQRYYELKEKDVLKF
G
FSSREYVLLHESSDTSEIDRKDDEDEEEEEEVSDS
Sequence length 396
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
19
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Psychomotor retardation, epilepsy, and craniofacial dysmorphism Likely pathogenic rs2522349649 RCV004586435
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Predisposition to dissection Uncertain significance rs41267307 RCV000791270
Self-limited epilepsy with centrotemporal spikes Uncertain significance rs202020647 RCV000655967
SNIP1-related disorder Benign; Conflicting classifications of pathogenicity; Likely benign rs2273013, rs387906986, rs61745973, rs80144754, rs137902870 RCV003983957
RCV004758597
RCV003933229
RCV003925867
RCV003943136
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 35589867
Carcinogenesis Associate 17157259
Carcinoma Non Small Cell Lung Associate 17157259, 36597175
Developmental Disabilities Associate 34570759
Enteritis Associate 34151668
Genetic Diseases Inborn Associate 34570759
Inflammatory Bowel Diseases Associate 34151668
Intellectual Disability Associate 34570759
Kifafa seizure disorder Associate 34570759
Lung Neoplasms Associate 36597175