Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
79750
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger protein 385D
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZNF385D
Synonyms (NCBI Gene) Gene synonyms aliases
ZNF659
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3p24.3
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT714750 hsa-miR-5088-3p HITS-CLIP 19536157
MIRT648956 hsa-miR-6734-3p HITS-CLIP 19536157
MIRT648957 hsa-miR-3667-3p HITS-CLIP 19536157
MIRT714749 hsa-miR-3124-3p HITS-CLIP 19536157
MIRT648955 hsa-miR-627-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005634 Component Nucleus IBA 21873635
GO:0008270 Function Zinc ion binding IEA
GO:1990837 Function Sequence-specific double-stranded DNA binding IDA 28473536
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
621200 26191 ENSG00000151789
Protein
UniProt ID Q9H6B1
Protein name Zinc finger protein 385D (Zinc finger protein 659)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12874 zf-met 80 104 Domain
PF12874 zf-met 204 228 Domain
PF12874 zf-met 267 291 Domain
Sequence
MRNIMYFGGTCQSPALPALVRPPAPPLQPSLDIKPFLPFPLDTAAAVNLFPNFNAMDPIQ
KAVINHTFGVPLPHRRKQIISCNICQLRFNSDSQAAAHYKGTKHAKKLKALEAMKNKQKS
VTAKDSAKTTFTSITTNTINTSSDKTDGTAGTPAISTTTTVEIRKSSVMTTEITSKVEKS
PTTATGNSSCPSTETEEEKAKRLLYCSLCKVAVNSASQLEAHNSGTKHKTMLEARNGSGT
IKAFPRAGVKGKGPVNKGNTGLQNKTFHCEICDVHVNSETQLKQHISSRRHKDRAAGKPP
KPKYSPYNKLQKTAHPLGVKLVFSKEPSKPLAPRILPNPLAAAAAAAAVAVSSPFSLRTA
PAATLFQTSALPPALLRPAPGPIRTAHTPVLFAPY
Sequence length 395
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Colorectal cancer Colorectal Carcinoma rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800
View all (467 more)
Narcolepsy Narcolepsy rs104894574, rs387906655 19629137
Prostate cancer Prostate carcinoma rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582 31095341
Unknown
Disease term Disease name Evidence References Source
Attention Deficit Hyperactivity Disorder Attention Deficit Hyperactivity Disorder GWAS
Bipolar Disorder Bipolar Disorder GWAS
Cervical Cancer Cervical Cancer Our screens identified 10 miRNAs that enhance fitness of HeLa cells and have been reported to be up-regulated in cervical cancer (Table2). GWAS, CBGDA
Metabolic Syndrome Metabolic Syndrome GWAS
Associations from Text Mining
Disease Name Relationship Type References
Bipolar Disorder Associate 24387768
Carcinoma Hepatocellular Associate 31322274
Dyslexia Acquired Associate 24024963
Language Disorders Associate 24024963
Mental Disorders Associate 39674387