Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
79738
Gene name Gene Name - the full gene name approved by the HGNC.
Bardet-Biedl syndrome 10
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
BBS10
Synonyms (NCBI Gene) Gene synonyms aliases
C12orf58
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q21.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of the Bardet-Biedl syndrome (BBS) gene family. Bardet-Biedl syndrome is an autosomal recessive disorder characterized by progressive retinal degeneration, obesity, polydactyly, renal malformation and cognitive disability. The protei
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs137852837 A>C Pathogenic Coding sequence variant, missense variant
rs139658279 C>T Conflicting-interpretations-of-pathogenicity, likely-benign, uncertain-significance Missense variant, coding sequence variant
rs141521925 T>C Conflicting-interpretations-of-pathogenicity, uncertain-significance Missense variant, coding sequence variant
rs143366878 A>T Conflicting-interpretations-of-pathogenicity Synonymous variant, coding sequence variant
rs148374859 G>C Pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019602 hsa-miR-340-5p Sequencing 20371350
MIRT021120 hsa-miR-186-5p Sequencing 20371350
MIRT563311 hsa-miR-548a-5p PAR-CLIP 20371350
MIRT563310 hsa-miR-548ab PAR-CLIP 20371350
MIRT563309 hsa-miR-548ad-5p PAR-CLIP 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0005515 Function Protein binding IPI 20080638, 28514442, 33961781
GO:0005524 Function ATP binding IEA
GO:0005929 Component Cilium IEA
GO:0007601 Process Visual perception IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610148 26291 ENSG00000179941
Protein
UniProt ID Q8TAM1
Protein name BBSome complex assembly protein BBS10 (Bardet-Biedl syndrome 10 protein)
Protein function Probable molecular chaperone that assists the folding of proteins upon ATP hydrolysis (PubMed:20080638). Plays a role in the assembly of BBSome, a complex involved in ciliogenesis regulating transports vesicles to the cilia (PubMed:20080638). In
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00118 Cpn60_TCP1 21 109 TCP-1/cpn60 chaperonin family Family
PF00118 Cpn60_TCP1 137 430 TCP-1/cpn60 chaperonin family Family
Sequence
MLSSMAAAGSVKAALQVAEVLEAIVSCCVGPEGRQVLCTKPTGEVLLSRNGGRLLEALHL
EHPIARMIVDCVSSHLKKTGDGAKTFIIFLCHLLRGLHAITDREKDPLM
CENIQTHGRHW
KNCSRWKFISQALLTFQTQILDGIMDQYLSRHFLSIFSSAKERTLCRSSLELLLEAYFCG
RVGRNNHKFISQLMCDYFFKCMTCKSGIGVFELVDDHFVELNVGVTGLPVSDSRIIAGLV
LQKDFSVYRPADGDMRMVIVTETIQPLFSTSGSEFILNSEAQFQTSQFWIMEKTKAIMKH
LHSQNVKLLISSVKQPDLVSYYAGVNGISVVECLSSEEVSLIRRIIGLSPFVPPQAFSQC
EIPNTALVKFCKPLILRSKRYVHLGLISTCAFIPHSIVLCGPVHGLIEQHEDALHGALKM
LRQLFKDLDL
NYMTQTNDQNGTSSLFIYKNSGESYQAPDPGNGSIQRPYQDTVAENKDAL
EKTQTYLKVHSNLVIPDVELETYIPYSTPTLTPTDTFQTVETLTCLSLERNRLTDYYEPL
LKNNSTAYSTRGNRIEISYENLQVTNITRKGSMLPVSCKLPNMGTSQSYLSSSMPAGCVL
PVGGNFEILLHYYLLNYAKKCHQSEETMVSMIIANALLGIPKVLYKSKTGKYSFPHTYIR
AVHALQTNQPLVSSQTGLESVMGKYQLLTSVLQCLTKILTIDMVITVKRHPQKVHNQDSE
DEL
Sequence length 723
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    BBSome-mediated cargo-targeting to cilium
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Bardet-Biedl Syndrome bardet-biedl syndrome 10, bardet-biedl syndrome, Bardet-Biedl syndrome 1 rs574032499, rs549625604, rs1460517643, rs1057516998, rs1951758601, rs869025211, rs886042729, rs1565809867, rs759185809, rs1057516861, rs1555202695, rs1555202697, rs1057517031, rs1592491950, rs786204575
View all (87 more)
N/A
retinal dystrophy Retinal dystrophy rs148374859, rs549625604, rs775950661, rs760693838, rs1555202584, rs137852837, rs768933093, rs375413604 N/A
Asphyxiating Thoracic Dystrophy Asphyxiating thoracic dystrophy 3 rs758522600 N/A
Retinitis Pigmentosa retinitis pigmentosa rs756632517, rs549625604 N/A
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Albinism Associate 39596324
Bardet Biedl Syndrome Associate 17980398, 20177705, 20876674, 21209035, 28143435, 28761321, 29806606, 30312873, 30335236, 31951329, 33138063, 33509858, 33964006, 34940782, 35112343
View all (2 more)
Breast Neoplasms Associate 29954368, 30947698
Ciliopathies Associate 35764379, 39596324
Cone Dystrophy Associate 34940782, 37031301
Cone Rod Dystrophies Associate 34940782
Gyrate Atrophy Associate 39596324
Insulin Resistance Associate 21209035
Intestinal Pseudo Obstruction Associate 21209035
Juberg Hayward syndrome Associate 33509858