Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	79731
Gene name Gene Name - the full gene name approved by the HGNC.	Asparaginyl-tRNA synthetase 2, mitochondrial
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NARS2
Synonyms (NCBI Gene) Gene synonyms aliases	DFNB94, SLM5, asnRS
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q14.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a putative member of the class II family of aminoacyl-tRNA synthetases. These enzymes play a critical role in protein biosynthesis by charging tRNAs with their cognate amino acids. This protein is encoded by the nuclear genome but is lik

Show/Hide all(15)

SNP ID	Visualize variation	Clinical significance	Consequence
rs201751992	T>C,G	Pathogenic, likely-pathogenic	Non coding transcript variant, coding sequence variant, 5 prime UTR variant, missense variant
rs367584549	G>A	Uncertain-significance, pathogenic	Non coding transcript variant, coding sequence variant, 5 prime UTR variant, missense variant
rs535877562	C>T	Likely-pathogenic	Non coding transcript variant, genic downstream transcript variant, coding sequence variant, missense variant
rs565224393	A>C,G,T	Likely-pathogenic	Genic downstream transcript variant, stop gained, synonymous variant, coding sequence variant, non coding transcript variant
rs730882155	G>A	Pathogenic	Coding sequence variant, 5 prime UTR variant, missense variant, non coding transcript variant
rs750594551	T>C	Pathogenic	Missense variant, 5 prime UTR variant, coding sequence variant, non coding transcript variant
rs751383065	G>A,C	Pathogenic, likely-pathogenic	Coding sequence variant, non coding transcript variant, genic downstream transcript variant, missense variant, stop gained
rs755122704	A>T	Pathogenic, likely-pathogenic	Missense variant, 5 prime UTR variant, coding sequence variant, non coding transcript variant
rs756725793	C>A,T	Likely-pathogenic	Missense variant, coding sequence variant, 5 prime UTR variant, non coding transcript variant
rs763770414	A>C,G	Pathogenic	Missense variant, coding sequence variant, genic downstream transcript variant, non coding transcript variant
rs1035101172	C>A,G,T	Pathogenic	Splice donor variant
rs1057524183	G>A	Likely-pathogenic	Non coding transcript variant, 5 prime UTR variant, stop gained, coding sequence variant
rs1064796717	C>-	Likely-pathogenic	Non coding transcript variant, intron variant, coding sequence variant, frameshift variant
rs1555047651	C>-	Pathogenic	Coding sequence variant, non coding transcript variant, frameshift variant, intron variant
rs1565216037	T>C	Likely-pathogenic	Coding sequence variant, non coding transcript variant, missense variant, genic downstream transcript variant

Show/Hide all(39)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029094	hsa-miR-26b-5p	Microarray	19088304
MIRT031482	hsa-miR-16-5p	Proteomics	18668040
MIRT032305	hsa-let-7b-5p	Proteomics	18668040
MIRT1174231	hsa-miR-183	CLIP-seq
MIRT1174232	hsa-miR-28-3p	CLIP-seq
MIRT1174233	hsa-miR-31	CLIP-seq
MIRT1174234	hsa-miR-3647-3p	CLIP-seq
MIRT1174235	hsa-miR-3662	CLIP-seq
MIRT1174236	hsa-miR-3682-5p	CLIP-seq
MIRT1174237	hsa-miR-3973	CLIP-seq
MIRT1174238	hsa-miR-4428	CLIP-seq
MIRT1174239	hsa-miR-4659a-3p	CLIP-seq
MIRT1174240	hsa-miR-4659b-3p	CLIP-seq
MIRT1174241	hsa-miR-4719	CLIP-seq
MIRT1174242	hsa-miR-4760-3p	CLIP-seq
MIRT1174243	hsa-miR-548l	CLIP-seq
MIRT1174244	hsa-miR-579	CLIP-seq
MIRT2050418	hsa-miR-1278	CLIP-seq
MIRT2050419	hsa-miR-145	CLIP-seq
MIRT2050420	hsa-miR-3140-3p	CLIP-seq
MIRT2050421	hsa-miR-342-5p	CLIP-seq
MIRT1174234	hsa-miR-3647-3p	CLIP-seq
MIRT1174235	hsa-miR-3662	CLIP-seq
MIRT2050422	hsa-miR-4270	CLIP-seq
MIRT2050423	hsa-miR-4441	CLIP-seq
MIRT2050424	hsa-miR-4664-5p	CLIP-seq
MIRT2050425	hsa-miR-4724-5p	CLIP-seq
MIRT2050426	hsa-miR-4765	CLIP-seq
MIRT2050418	hsa-miR-1278	CLIP-seq
MIRT2279467	hsa-miR-2276	CLIP-seq
MIRT2050425	hsa-miR-4724-5p	CLIP-seq
MIRT2279468	hsa-miR-4772-3p	CLIP-seq
MIRT2279469	hsa-miR-544	CLIP-seq
MIRT2391352	hsa-miR-323-3p	CLIP-seq
MIRT2391353	hsa-miR-4652-3p	CLIP-seq
MIRT2391354	hsa-miR-4778-5p	CLIP-seq
MIRT2577691	hsa-miR-1279	CLIP-seq
MIRT2577692	hsa-miR-203	CLIP-seq
MIRT2577693	hsa-miR-4275	CLIP-seq

Show/Hide all(21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0004812	Function	Aminoacyl-tRNA ligase activity	IEA
GO:0004816	Function	Asparagine-tRNA ligase activity	IBA
GO:0004816	Function	Asparagine-tRNA ligase activity	IEA
GO:0004816	Function	Asparagine-tRNA ligase activity	ISS
GO:0005524	Function	ATP binding	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	25807530
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	ISS
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006412	Process	Translation	IEA
GO:0006418	Process	TRNA aminoacylation for protein translation	IEA
GO:0006421	Process	Asparaginyl-tRNA aminoacylation	IBA
GO:0006421	Process	Asparaginyl-tRNA aminoacylation	IEA
GO:0006421	Process	Asparaginyl-tRNA aminoacylation	ISS
GO:0016874	Function	Ligase activity	IEA

MIM	HGNC	e!Ensembl
612803	26274	ENSG00000137513

Protein

UniProt ID

Q96I59

Protein name

Asparaginyl-tRNA synthetase (AsnRS) (NARS2) (EC 6.1.1.22) (Asparagine--tRNA ligase, mitochondrial)

Protein function

Mitochondrial aminoacyl-tRNA synthetase that catalyzes the specific attachment of the asparagine amino acid (aa) to the homologous transfer RNA (tRNA), further participating in protein synthesis (PubMed:25385316). The reaction occurs in a two st

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01336	tRNA_anti-codon	44 → 118	OB-fold nucleic acid binding domain	Domain
PF00152	tRNA-synt_2	135 → 472	tRNA synthetases class II (D, K and N)	Domain

Sequence

MLGVRCLLRSVRFCSSAPFPKHKPSAKLSVRDALGAQNASGERIKIQGWIRSVRSQKEVL
FLHVNDGSSLESLQVVADSGLDSRELNFGSSVEVQGQLIKSPSKRQNVELKAEKIKVIGN
CDAKDFPIKYKERHPLEYLRQYPHFRCRTNVLGSILRIRSEATAAIHSFFKDSGFVHIHT
PIITSNDSEGAGELFQLEPSGKLKVPEENFFNVPAFLTVSGQLHLEVMSGAFTQVFTFGP
TFRAENSQSRRHLAEFYMIEAEISFVDSLQDLMQVIEELFKATTMMVLSKCPEDVELCHK
FIAPGQKDRLEHMLKNNFLIISYTEAVEILKQASQNFTFTPEWGADLRTEHEKYLVKHCG
NIPVFVINYPLTLKPFYMRDNEDGPQHTVAAVDLLVPGVGELFGGGLREERYHFLEERLA
RSGLTEVYQWYLDLRRFGSVPHGGFGMGFERYLQCILGVDNIKDVIPFPRFPHSCLL

Sequence length

477

Interactions

View interactions

	KEGG
	Aminoacyl-tRNA biosynthesis

Show/Hide Causal Diseases (3)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Combined Oxidative Phosphorylation Deficiency	combined oxidative phosphorylation defect type 24	rs1565216037, rs1035101172, rs1565235204, rs763770414, rs730882154, rs748779965, rs730882155, rs1057524183, rs755122704, rs565224393	N/A
Hearing Loss	Hearing loss, autosomal recessive 94	rs952741388	N/A
Hepatoencephalopathy	hepatoencephalopathy due to combined oxidative phosphorylation defect type 1	rs1555047651	N/A

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Leigh Syndrome	Leigh syndrome	N/A	N/A	GenCC
Mitochondrial Diseases	mitochondrial disease	N/A	N/A	GenCC

Show/Hide Text Mining Associations (23)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Alzheimer Disease	Associate	25649651
Arthritis	Associate	17393393
Brain Diseases	Associate	37950505
Cerebral Hemorrhage	Associate	37950505
Connective Tissue Diseases	Associate	17393393
Deafness	Associate	36252909
Developmental Disabilities	Associate	37950505
Diffuse Cerebral Sclerosis of Schilder	Associate	33596490
Hearing Loss	Associate	37950505
Hematoma Subdural	Associate	37950505
Hemorrhage	Associate	37950505
Hypersensitivity Delayed	Associate	37950505
Leigh Disease	Associate	36675121
Lung Diseases Interstitial	Associate	17393393
Lymphoma	Associate	33883344
Lymphoma B Cell	Associate	33883344
Mental Disorders	Associate	36252909
Mitochondrial encephalopathy	Associate	33596490
Mitochondrial Myopathies	Associate	36252909
Multiple Trauma	Associate	40446056
Myotonic Dystrophy	Associate	17393393
Neurodegenerative Diseases	Associate	36252909
Seizures	Associate	37950505

NARS2 (asparaginyl-tRNA synthetase 2, mitochondrial)