Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	79723
Gene name	SUV39H2 histone lysine methyltransferase
Gene symbol	SUV39H2
Synonyms (NCBI Gene)	KMT1B
Chromosome	10
Chromosome location	10p13

233

Show/Hide all (233)

miRTarBase ID	miRNA	Experiments	Reference
MIRT560846	hsa-miR-6768-3p	PAR-CLIP	20371350
MIRT560845	hsa-miR-3156-5p	PAR-CLIP	20371350
MIRT560844	hsa-miR-181a-5p	PAR-CLIP	20371350
MIRT560843	hsa-miR-181b-5p	PAR-CLIP	20371350
MIRT560842	hsa-miR-181c-5p	PAR-CLIP	20371350
MIRT560841	hsa-miR-181d-5p	PAR-CLIP	20371350
MIRT560839	hsa-miR-4262	PAR-CLIP	20371350
MIRT560840	hsa-miR-4733-5p	PAR-CLIP	20371350
MIRT560838	hsa-miR-95-5p	PAR-CLIP	20371350
MIRT560837	hsa-miR-885-5p	PAR-CLIP	20371350
MIRT560836	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT560846	hsa-miR-6768-3p	PAR-CLIP	20371350
MIRT560845	hsa-miR-3156-5p	PAR-CLIP	20371350
MIRT560844	hsa-miR-181a-5p	PAR-CLIP	20371350
MIRT560843	hsa-miR-181b-5p	PAR-CLIP	20371350
MIRT560842	hsa-miR-181c-5p	PAR-CLIP	20371350
MIRT560841	hsa-miR-181d-5p	PAR-CLIP	20371350
MIRT560839	hsa-miR-4262	PAR-CLIP	20371350
MIRT560840	hsa-miR-4733-5p	PAR-CLIP	20371350
MIRT560838	hsa-miR-95-5p	PAR-CLIP	20371350
MIRT560837	hsa-miR-885-5p	PAR-CLIP	20371350
MIRT560836	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT560846	hsa-miR-6768-3p	PAR-CLIP	20371350
MIRT560845	hsa-miR-3156-5p	PAR-CLIP	20371350
MIRT560844	hsa-miR-181a-5p	PAR-CLIP	20371350
MIRT560843	hsa-miR-181b-5p	PAR-CLIP	20371350
MIRT560842	hsa-miR-181c-5p	PAR-CLIP	20371350
MIRT560841	hsa-miR-181d-5p	PAR-CLIP	20371350
MIRT560839	hsa-miR-4262	PAR-CLIP	20371350
MIRT560840	hsa-miR-4733-5p	PAR-CLIP	20371350
MIRT560838	hsa-miR-95-5p	PAR-CLIP	20371350
MIRT560837	hsa-miR-885-5p	PAR-CLIP	20371350
MIRT560836	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT560846	hsa-miR-6768-3p	PAR-CLIP	20371350
MIRT560845	hsa-miR-3156-5p	PAR-CLIP	20371350
MIRT560844	hsa-miR-181a-5p	PAR-CLIP	20371350
MIRT560843	hsa-miR-181b-5p	PAR-CLIP	20371350
MIRT560842	hsa-miR-181c-5p	PAR-CLIP	20371350
MIRT560841	hsa-miR-181d-5p	PAR-CLIP	20371350
MIRT560839	hsa-miR-4262	PAR-CLIP	20371350
MIRT560840	hsa-miR-4733-5p	PAR-CLIP	20371350
MIRT560838	hsa-miR-95-5p	PAR-CLIP	20371350
MIRT560837	hsa-miR-885-5p	PAR-CLIP	20371350
MIRT560836	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT1404211	hsa-miR-1200	CLIP-seq
MIRT1404212	hsa-miR-3074-3p	CLIP-seq
MIRT1404213	hsa-miR-3074-5p	CLIP-seq
MIRT1404214	hsa-miR-3130-5p	CLIP-seq
MIRT1404215	hsa-miR-3140-5p	CLIP-seq
MIRT1404216	hsa-miR-374a	CLIP-seq
MIRT1404217	hsa-miR-374b	CLIP-seq
MIRT1404218	hsa-miR-4482	CLIP-seq
MIRT1404219	hsa-miR-4712-3p	CLIP-seq
MIRT1404220	hsa-miR-4786-5p	CLIP-seq
MIRT1404221	hsa-miR-548p	CLIP-seq
MIRT1404222	hsa-miR-622	CLIP-seq
MIRT1404223	hsa-miR-656	CLIP-seq
MIRT1404224	hsa-miR-769-5p	CLIP-seq
MIRT1404225	hsa-miR-103b	CLIP-seq
MIRT1404211	hsa-miR-1200	CLIP-seq
MIRT1404226	hsa-miR-1227	CLIP-seq
MIRT1404227	hsa-miR-1254	CLIP-seq
MIRT1404228	hsa-miR-1271	CLIP-seq
MIRT1404229	hsa-miR-1304	CLIP-seq
MIRT1404230	hsa-miR-133a	CLIP-seq
MIRT1404231	hsa-miR-133b	CLIP-seq
MIRT1404232	hsa-miR-144	CLIP-seq
MIRT1404233	hsa-miR-182	CLIP-seq
MIRT1404234	hsa-miR-183	CLIP-seq
MIRT1404235	hsa-miR-200b	CLIP-seq
MIRT1404236	hsa-miR-200c	CLIP-seq
MIRT1404237	hsa-miR-2053	CLIP-seq
MIRT1404238	hsa-miR-24	CLIP-seq
MIRT1404239	hsa-miR-300	CLIP-seq
MIRT1404240	hsa-miR-30a	CLIP-seq
MIRT1404241	hsa-miR-30b	CLIP-seq
MIRT1404242	hsa-miR-30c	CLIP-seq
MIRT1404243	hsa-miR-30d	CLIP-seq
MIRT1404244	hsa-miR-30e	CLIP-seq
MIRT1404245	hsa-miR-31	CLIP-seq
MIRT1404246	hsa-miR-3116	CLIP-seq
MIRT1404247	hsa-miR-3163	CLIP-seq
MIRT1404248	hsa-miR-3187-3p	CLIP-seq
MIRT1404249	hsa-miR-3199	CLIP-seq
MIRT1404250	hsa-miR-323-3p	CLIP-seq
MIRT1404251	hsa-miR-330-3p	CLIP-seq
MIRT1404252	hsa-miR-331-5p	CLIP-seq
MIRT1404253	hsa-miR-361-5p	CLIP-seq
MIRT1404254	hsa-miR-3671	CLIP-seq
MIRT1404255	hsa-miR-371-5p	CLIP-seq
MIRT1404256	hsa-miR-371b-5p	CLIP-seq
MIRT1404257	hsa-miR-374c	CLIP-seq
MIRT1404258	hsa-miR-381	CLIP-seq
MIRT1404259	hsa-miR-382	CLIP-seq
MIRT1404260	hsa-miR-3908	CLIP-seq
MIRT1404261	hsa-miR-3926	CLIP-seq
MIRT1404262	hsa-miR-3942-3p	CLIP-seq
MIRT1404263	hsa-miR-3942-5p	CLIP-seq
MIRT1404264	hsa-miR-4254	CLIP-seq
MIRT1404265	hsa-miR-4257	CLIP-seq
MIRT1404266	hsa-miR-4269	CLIP-seq
MIRT1404267	hsa-miR-4282	CLIP-seq
MIRT1404268	hsa-miR-4284	CLIP-seq
MIRT1404269	hsa-miR-429	CLIP-seq
MIRT1404270	hsa-miR-431	CLIP-seq
MIRT1404271	hsa-miR-4315	CLIP-seq
MIRT1404272	hsa-miR-4324	CLIP-seq
MIRT1404273	hsa-miR-4435	CLIP-seq
MIRT1404274	hsa-miR-4438	CLIP-seq
MIRT1404275	hsa-miR-4470	CLIP-seq
MIRT1404276	hsa-miR-4480	CLIP-seq
MIRT1404277	hsa-miR-4495	CLIP-seq
MIRT1404278	hsa-miR-4514	CLIP-seq
MIRT1404279	hsa-miR-4635	CLIP-seq
MIRT1404280	hsa-miR-4640-3p	CLIP-seq
MIRT1404281	hsa-miR-4670-3p	CLIP-seq
MIRT1404282	hsa-miR-4692	CLIP-seq
MIRT1404283	hsa-miR-4701-5p	CLIP-seq
MIRT1404284	hsa-miR-4703-5p	CLIP-seq
MIRT1404285	hsa-miR-4715-3p	CLIP-seq
MIRT1404286	hsa-miR-4742-5p	CLIP-seq
MIRT1404287	hsa-miR-4760-3p	CLIP-seq
MIRT1404288	hsa-miR-4766-3p	CLIP-seq
MIRT1404289	hsa-miR-4772-3p	CLIP-seq
MIRT1404290	hsa-miR-4804-3p	CLIP-seq
MIRT1404291	hsa-miR-494	CLIP-seq
MIRT1404292	hsa-miR-5095	CLIP-seq
MIRT1404293	hsa-miR-544b	CLIP-seq
MIRT1404294	hsa-miR-548c-3p	CLIP-seq
MIRT1404295	hsa-miR-548s	CLIP-seq
MIRT1404296	hsa-miR-556-5p	CLIP-seq
MIRT1404297	hsa-miR-569	CLIP-seq
MIRT1404298	hsa-miR-570	CLIP-seq
MIRT1404299	hsa-miR-588	CLIP-seq
MIRT1404300	hsa-miR-603	CLIP-seq
MIRT1404301	hsa-miR-607	CLIP-seq
MIRT1404302	hsa-miR-655	CLIP-seq
MIRT1404223	hsa-miR-656	CLIP-seq
MIRT1404303	hsa-miR-96	CLIP-seq
MIRT1404220	hsa-miR-4786-5p	CLIP-seq
MIRT1404224	hsa-miR-769-5p	CLIP-seq
MIRT1404211	hsa-miR-1200	CLIP-seq
MIRT1404272	hsa-miR-4324	CLIP-seq
MIRT1404293	hsa-miR-544b	CLIP-seq
MIRT1404211	hsa-miR-1200	CLIP-seq
MIRT2343182	hsa-miR-1297	CLIP-seq
MIRT2343183	hsa-miR-1976	CLIP-seq
MIRT2343184	hsa-miR-26a	CLIP-seq
MIRT2343185	hsa-miR-26b	CLIP-seq
MIRT1404240	hsa-miR-30a	CLIP-seq
MIRT1404241	hsa-miR-30b	CLIP-seq
MIRT1404242	hsa-miR-30c	CLIP-seq
MIRT1404243	hsa-miR-30d	CLIP-seq
MIRT1404244	hsa-miR-30e	CLIP-seq
MIRT1404249	hsa-miR-3199	CLIP-seq
MIRT2343186	hsa-miR-337-3p	CLIP-seq
MIRT2343187	hsa-miR-3663-5p	CLIP-seq
MIRT2343188	hsa-miR-3934	CLIP-seq
MIRT2343189	hsa-miR-4279	CLIP-seq
MIRT1404272	hsa-miR-4324	CLIP-seq
MIRT1404273	hsa-miR-4435	CLIP-seq
MIRT1404274	hsa-miR-4438	CLIP-seq
MIRT2343190	hsa-miR-4465	CLIP-seq
MIRT1404277	hsa-miR-4495	CLIP-seq
MIRT2343191	hsa-miR-450b-3p	CLIP-seq
MIRT1404279	hsa-miR-4635	CLIP-seq
MIRT2343192	hsa-miR-4650-5p	CLIP-seq
MIRT2343193	hsa-miR-4713-3p	CLIP-seq
MIRT2343194	hsa-miR-4722-3p	CLIP-seq
MIRT2343195	hsa-miR-4735-5p	CLIP-seq
MIRT2343196	hsa-miR-4755-3p	CLIP-seq
MIRT2343197	hsa-miR-4775	CLIP-seq
MIRT1404292	hsa-miR-5095	CLIP-seq
MIRT2343198	hsa-miR-512-3p	CLIP-seq
MIRT2343199	hsa-miR-513a-5p	CLIP-seq
MIRT1404293	hsa-miR-544b	CLIP-seq
MIRT2343200	hsa-miR-552	CLIP-seq
MIRT2343201	hsa-miR-590-3p	CLIP-seq
MIRT2343202	hsa-miR-638	CLIP-seq
MIRT2343203	hsa-miR-769-3p	CLIP-seq
MIRT1404211	hsa-miR-1200	CLIP-seq
MIRT1404226	hsa-miR-1227	CLIP-seq
MIRT2343182	hsa-miR-1297	CLIP-seq
MIRT2343183	hsa-miR-1976	CLIP-seq
MIRT2343184	hsa-miR-26a	CLIP-seq
MIRT2343185	hsa-miR-26b	CLIP-seq
MIRT1404249	hsa-miR-3199	CLIP-seq
MIRT2343189	hsa-miR-4279	CLIP-seq
MIRT1404272	hsa-miR-4324	CLIP-seq
MIRT1404274	hsa-miR-4438	CLIP-seq
MIRT2433745	hsa-miR-4452	CLIP-seq
MIRT2343190	hsa-miR-4465	CLIP-seq
MIRT2433746	hsa-miR-4680-3p	CLIP-seq
MIRT2343194	hsa-miR-4722-3p	CLIP-seq
MIRT1404292	hsa-miR-5095	CLIP-seq
MIRT1404293	hsa-miR-544b	CLIP-seq
MIRT1404285	hsa-miR-4715-3p	CLIP-seq
MIRT2637021	hsa-miR-1183	CLIP-seq
MIRT1404226	hsa-miR-1227	CLIP-seq
MIRT2637022	hsa-miR-1281	CLIP-seq
MIRT2343182	hsa-miR-1297	CLIP-seq
MIRT2637023	hsa-miR-199a-3p	CLIP-seq
MIRT2637024	hsa-miR-199b-3p	CLIP-seq
MIRT2343184	hsa-miR-26a	CLIP-seq
MIRT2343185	hsa-miR-26b	CLIP-seq
MIRT2637025	hsa-miR-3129-5p	CLIP-seq
MIRT1404215	hsa-miR-3140-5p	CLIP-seq
MIRT2637026	hsa-miR-3149	CLIP-seq
MIRT1404249	hsa-miR-3199	CLIP-seq
MIRT2637027	hsa-miR-3935	CLIP-seq
MIRT1404274	hsa-miR-4438	CLIP-seq
MIRT2433745	hsa-miR-4452	CLIP-seq
MIRT2343190	hsa-miR-4465	CLIP-seq
MIRT2433746	hsa-miR-4680-3p	CLIP-seq
MIRT1404285	hsa-miR-4715-3p	CLIP-seq
MIRT2343195	hsa-miR-4735-5p	CLIP-seq
MIRT2343197	hsa-miR-4775	CLIP-seq
MIRT1404292	hsa-miR-5095	CLIP-seq
MIRT1404221	hsa-miR-548p	CLIP-seq
MIRT2343201	hsa-miR-590-3p	CLIP-seq
MIRT2637028	hsa-miR-936	CLIP-seq
MIRT2637021	hsa-miR-1183	CLIP-seq
MIRT1404226	hsa-miR-1227	CLIP-seq
MIRT2637026	hsa-miR-3149	CLIP-seq
MIRT1404249	hsa-miR-3199	CLIP-seq
MIRT2637027	hsa-miR-3935	CLIP-seq
MIRT1404274	hsa-miR-4438	CLIP-seq
MIRT1404285	hsa-miR-4715-3p	CLIP-seq
MIRT2343195	hsa-miR-4735-5p	CLIP-seq
MIRT2343197	hsa-miR-4775	CLIP-seq
MIRT1404292	hsa-miR-5095	CLIP-seq
MIRT1404221	hsa-miR-548p	CLIP-seq
MIRT2343201	hsa-miR-590-3p	CLIP-seq

Show/Hide all (38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	21402781
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000785	Component	Chromatin	IDA	10949293
GO:0000785	Component	Chromatin	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	ISS
GO:0005515	Function	Protein binding	IPI	17474147, 23455924, 25416956, 31515488, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	30111536
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006325	Process	Chromatin organization	IMP	10949293
GO:0006338	Process	Chromatin remodeling	IDA	10949293
GO:0007623	Process	Circadian rhythm	ISS
GO:0008168	Function	Methyltransferase activity	IEA
GO:0008270	Function	Zinc ion binding	IDA	20084102
GO:0008270	Function	Zinc ion binding	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0032259	Process	Methylation	IEA
GO:0042054	Function	Histone methyltransferase activity	IEA
GO:0044725	Process	Epigenetic programming in the zygotic pronuclei	IDA	30111536
GO:0044725	Process	Epigenetic programming in the zygotic pronuclei	IEA
GO:0045814	Process	Negative regulation of gene expression, epigenetic	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0046974	Function	Histone H3K9 methyltransferase activity	IBA
GO:0046974	Function	Histone H3K9 methyltransferase activity	IDA	10949293
GO:0046974	Function	Histone H3K9 methyltransferase activity	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0071456	Process	Cellular response to hypoxia	IDA	21402781
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0140938	Function	Histone H3 methyltransferase activity	TAS
GO:0140949	Function	Histone H3K9 trimethyltransferase activity	IEA
GO:1904047	Function	S-adenosyl-L-methionine binding	IDA	20084102
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IDA	30111536

MIM	HGNC	e!Ensembl
606503	17287	ENSG00000152455

Q9H5I1

Protein name

Histone-lysine N-methyltransferase SUV39H2 (EC 2.1.1.355) (Histone H3-K9 methyltransferase 2) (H3-K9-HMTase 2) (Lysine N-methyltransferase 1B) (Suppressor of variegation 3-9 homolog 2) (Su(var)3-9 homolog 2)

Protein function

Histone methyltransferase that specifically trimethylates 'Lys-9' of histone H3 using monomethylated H3 'Lys-9' as substrate. H3 'Lys-9' trimethylation represents a specific tag for epigenetic transcriptional repression by recruiting HP1 (CBX1,

PDB

2R3A , 6P0R

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00385	Chromo	47 → 96	Chromo (CHRromatin Organisation MOdifier) domain	Domain
PF05033	Pre-SET	145 → 242	Pre-SET motif	Family
PF00856	SET	262 → 373	SET domain	Family

Sequence

MAAVGAEARGAWCVPCLVSLDTLQELCRKEKLTCKSIGITKRNLNNYEVEYLCDYKVVKD
MEYYLVKWKGWPDSTNTWEPLQNLKCPLLLQQFSNDKHNYLSQVKKGKAITPKDNNKTLK
PAIAEYIVKKAKQRIALQRWQDELNRRKNHKGMIFVENTVDLEGPPSDFYYINEYKPAPG
ISLVNEATFGCSCTDCFFQKCCPAEAGVLLAYNKNQQIKIPPGTPIYECNSRCQCGPDCP
NRIVQKGTQYSLCIFRTSNGRGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQFYDNK
GITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTR
TINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN

Sequence length

410

Interactions

View interactions

	KEGG		Reactome
	Lysine degradation Metabolic pathways		PKMTs methylate histone lysines

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
SUV39H2-related disorder	Likely benign	rs978587789	RCV003937098

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Carcinoma Hepatocellular	Associate	24966962
Carcinoma Non Small Cell Lung	Stimulate	33658396
Hepatitis C	Associate	24966962
Intervertebral Disc Degeneration	Associate	37605006
Intervertebral disc disease	Associate	37605006
Latent Autoimmune Diabetes in Adults	Associate	28396876
Neoplasms	Associate	16638127, 24966962
Niemann Pick Disease Type C	Associate	37605006
Purpura Thrombocytopenic Idiopathic	Inhibit	24433164

SUV39H2 (SUV39H2 histone lysine methyltransferase)