ANKRD55 (ankyrin repeat domain 55)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
79722
Gene name Gene Name - the full gene name approved by the HGNC.
Ankyrin repeat domain 55
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ANKRD55
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q11.2
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(33)
miRTarBase ID miRNA Experiments Reference
MIRT1931528 hsa-miR-1231 CLIP-seq
MIRT1931529 hsa-miR-1273g CLIP-seq
MIRT1931530 hsa-miR-224 CLIP-seq
MIRT1931531 hsa-miR-27a CLIP-seq
MIRT1931532 hsa-miR-27b CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(1)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
615189 25681 ENSG00000164512
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q3KP44
Protein name Ankyrin repeat domain-containing protein 55
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12796 Ank_2 6 → 91 Ankyrin repeats (3 copies) Repeat
PF12796 Ank_2 98 → 192 Ankyrin repeats (3 copies) Repeat
PF12796 Ank_2 245 → 328 Ankyrin repeats (3 copies) Repeat
Sequence 
MMRQATMDFSTPSVFDQQRGDSSEEVDLTMVYQAASNGDVNALTAVIREDPSILECCDSE
GCTPLMHAVSGRQADTVKLLLKMGANINMQDAYGRTSLCLATYLGWLEGCVSLLRNGAKH
NIPDKNGRLPLHAATAEPDMRLLTVLLQQSNISEINHQDNEGMTPLHWAAFHNQPQHTQM
LLKKGADPTLVDKDFKTALHWAVQSGNRILCSIILSHHQGPSIINYDDESGKTCVHIAAA
AGFSDIIHELARVPECNLQALDVDDRTPLHWAAAAGKAECVQSLLELGMDSNLRDINEST
PLAYALYCGHTACVKLLSQESRTEPTRPPPSQSSRPQKKERRFNVLNQIFCKNKKEEQRA
HQKDPSRDRYREEDTSEVNDIITTFDSIVGTNCQEQPGDQVAMVEFKKKTSDNSKYLLPE
KKPLARKGLPPIRTQSLPPITLGNNFLTASHRATSHAGLSSAPHHMAQRSQKSRSEQDLL
NNRTGCQMLLDNPWKSDSNQVFSYKVWTVSSSDKLLDRLLSVRPGHQEVSVPPHLRHLHN
PSSGQNFQHLSPNRHKIRDLPFTRNNLAPLPDQKFLSGEPLRTNRVLPAIPSQRRHSTAA
EESEHSANPTSDEN
Sequence length 614
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (7)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Coronary artery disease Coronary artery disease N/A N/A GWAS
Crohn Disease Crohn's disease N/A N/A GWAS
Dermatitis Atopic dermatitis N/A N/A GWAS
Inflammatory Bowel Disease Inflammatory bowel disease N/A N/A GWAS
Show/Hide Text Mining Associations (16)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Arthritis Rheumatoid Associate 22355377, 26895230, 31620119, 31945409, 35111166
Asthma Associate 31945409
Autoimmune Diseases Associate 28470010, 31620119
Dermatomyositis Associate 28470010, 30157932
Diabetes Mellitus Type 2 Inhibit 30352878
Glaucoma Open Angle Associate 29452408
Lung Diseases Interstitial Associate 28470010
Multiple Sclerosis Associate 31620119, 31945409, 35111166
Myotonic Dystrophy Associate 28470010
Neoplasms Adipose Tissue Associate 30352878