ANKRD55 (ankyrin repeat domain 55)

Gene

• Entrez ID: 79722
• Gene name: Ankyrin repeat domain 55
• Gene symbol: ANKRD55
• Synonyms (NCBI Gene): -
• Chromosome: 5
• Chromosome location: 5q11.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1931528	hsa-miR-1231	CLIP-seq
MIRT1931529	hsa-miR-1273g	CLIP-seq
MIRT1931530	hsa-miR-224	CLIP-seq
MIRT1931531	hsa-miR-27a	CLIP-seq
MIRT1931532	hsa-miR-27b	CLIP-seq
MIRT1931533	hsa-miR-3190	CLIP-seq
MIRT1931534	hsa-miR-3192	CLIP-seq
MIRT1931535	hsa-miR-4288	CLIP-seq
MIRT1931536	hsa-miR-4314	CLIP-seq
MIRT1931537	hsa-miR-4491	CLIP-seq
MIRT1931538	hsa-miR-4646-5p	CLIP-seq
MIRT1931539	hsa-miR-4657	CLIP-seq
MIRT1931540	hsa-miR-4764-5p	CLIP-seq
MIRT1931541	hsa-miR-513a-5p	CLIP-seq
MIRT1931542	hsa-miR-632	CLIP-seq
MIRT1931528	hsa-miR-1231	CLIP-seq
MIRT1931529	hsa-miR-1273g	CLIP-seq
MIRT2475036	hsa-miR-129-5p	CLIP-seq
MIRT1931534	hsa-miR-3192	CLIP-seq
MIRT1931535	hsa-miR-4288	CLIP-seq
MIRT1931536	hsa-miR-4314	CLIP-seq
MIRT1931538	hsa-miR-4646-5p	CLIP-seq
MIRT1931540	hsa-miR-4764-5p	CLIP-seq
MIRT1931542	hsa-miR-632	CLIP-seq
MIRT1931528	hsa-miR-1231	CLIP-seq
MIRT1931529	hsa-miR-1273g	CLIP-seq
MIRT2475036	hsa-miR-129-5p	CLIP-seq
MIRT1931534	hsa-miR-3192	CLIP-seq
MIRT1931535	hsa-miR-4288	CLIP-seq
MIRT1931536	hsa-miR-4314	CLIP-seq
MIRT1931538	hsa-miR-4646-5p	CLIP-seq
MIRT1931540	hsa-miR-4764-5p	CLIP-seq
MIRT1931542	hsa-miR-632	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183

Other IDs

• MIM: 615189
• HGNC: 25681
• e!Ensembl: ENSG00000164512

Protein

• UniProt ID: Q3KP44
• Protein name: Ankyrin repeat domain-containing protein 55
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12796	Ank_2	6 → 91	Ankyrin repeats (3 copies)	Repeat
  PF12796	Ank_2	98 → 192	Ankyrin repeats (3 copies)	Repeat
  PF12796	Ank_2	245 → 328	Ankyrin repeats (3 copies)	Repeat

• Sequence:

  MMRQATMDFSTPSVFDQQRGDSSEEVDLTMVYQAASNGDVNALTAVIREDPSILECCDSE
  GCTPLMHAVSGRQADTVKLLLKMGANINMQDAYGRTSLCLATYLGWLEGCVSLLRNGAKH
  NIPDKNGRLPLHAATAEPDMRLLTVLLQQSNISEINHQDNEGMTPLHWAAFHNQPQHTQM
  LLKKGADPTLVDKDFKTALHWAVQSGNRILCSIILSHHQGPSIINYDDESGKTCVHIAAA
  AGFSDIIHELARVPECNLQALDVDDRTPLHWAAAAGKAECVQSLLELGMDSNLRDINEST
  PLAYALYCGHTACVKLLSQESRTEPTRPPPSQSSRPQKKERRFNVLNQIFCKNKKEEQRA
  HQKDPSRDRYREEDTSEVNDIITTFDSIVGTNCQEQPGDQVAMVEFKKKTSDNSKYLLPE
  KKPLARKGLPPIRTQSLPPITLGNNFLTASHRATSHAGLSSAPHHMAQRSQKSRSEQDLL
  NNRTGCQMLLDNPWKSDSNQVFSYKVWTVSSSDKLLDRLLSVRPGHQEVSVPPHLRHLHN
  PSSGQNFQHLSPNRHKIRDLPFTRNNLAPLPDQKFLSGEPLRTNRVLPAIPSQRRHSTAA
  EESEHSANPTSDEN

• Sequence length: 614

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Alzheimer disease	Alzheimer`s Disease	rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039, rs63750973, rs63749810, rs63750643, rs193922916, rs63750306, rs63750590, rs63750526, rs63751235, rs661, rs63751037, rs63749885, rs63750231, rs63751229, rs63751272, rs63751223, rs63750391, rs63751163, rs281875357, rs63751141, rs63750082, rs121917807, rs63751399, rs63750265, rs63751144, rs63750886, rs63751068, rs121917808, rs63749891, rs63750083, rs63749824, rs63750577, rs267606983, rs63750218, rs63751287, rs63750900, rs63751475, rs63750450, rs63749805, rs63751278, rs63751106, rs63750004, rs63749806, rs63751024, rs63750248, rs63750779, rs63751139, rs63750219, rs63750298, rs63750687, rs63750851, rs1553268799, rs1561901881, rs1561905293, rs866101707, rs1566638673, rs63750009, rs1566656702, rs1566657804, rs1567885728, rs1568339995, rs1566630791, rs1555358260, rs63750964, rs1594998354, rs63751316	23535033
Apraxia	Apraxias	rs121908377, rs121908378, rs1135401820, rs1178491246, rs1584969672
Arthritis	Systemic onset juvenile chronic arthritis, Juvenile arthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470	23603761, 26301688
Autoimmune diseases	Autoimmune Diseases, AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 1, AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 2	rs869025224	26301688, 21383967
Common variable immunodeficiency	Common Variable Immunodeficiency	rs72553883, rs121908379, rs104894650, rs587776775, rs398122863, rs398122864, rs397514332, rs397514331, rs727502786, rs727502787, rs72553882, rs869320688, rs869320689, rs869320754, rs773694113, rs1553319504, rs201017642, rs1555550717, rs1558192723, rs1030733127, rs749636258, rs185689791, rs1559035937, rs1565214594, rs1560679469, rs1560711146, rs1569376229, rs1578790573, rs939459600, rs1572952530, rs1572950925, rs772481080, rs369363360, rs72553885, rs72553879, rs1265262160, rs1303637368, rs757598952, rs1016142312, rs1578771120, rs1578771197, rs1578793298, rs1578793312, rs1578809101, rs1578811073, rs1590715754, rs144718007, rs759649059, rs1723945421, rs2061279365	26301688
Diabetes mellitus	Diabetes Mellitus, Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237, rs80356613, rs387906407, rs151344623, rs28938469, rs28936371, rs137852672, rs80356637, rs80356642, rs80356653, rs137852673, rs137852674, rs80356634, rs80356651, rs193929360, rs137853334, rs137853335, rs137853336, rs1600731198, rs137853338, rs121964882, rs121964883, rs387906511, rs121964884, rs121964885, rs2147483647, rs387906512, rs121964887, rs121964888, rs121964889, rs121964890, rs121964891, rs28934878, rs74315383, rs121964893, rs886037620, rs886037621, rs121434593, rs121913150, rs587776825, rs137853236, rs2135842335, rs137853237, rs137853238, rs2135818776, rs1566092470, rs1463923467, rs137853243, rs137853244, rs2135839114, rs137853245, rs2135847417, rs121918407, rs104894005, rs104894006, rs80356655, rs104894008, rs104894009, rs104894010, rs104894011, rs80356654, rs104894016, rs193929376, rs193929374, rs193929375, rs193929373, rs80356669, rs80356664, rs193929366, rs1048095, rs193929355, rs193929356, rs1259467443, rs104893642, rs387906777, rs193922396, rs193922400, rs193922401, rs137852676, rs193922407, rs193922638, rs193922257, rs193922258, rs193922259, rs193922260, rs193922261, rs193922262, rs193922263, rs193922264, rs193922265, rs193922268, rs193921338, rs193922269, rs193922272, rs193922273, rs193922275, rs193922278, rs193922279, rs193922280, rs193922281, rs193922282, rs193922283, rs193922284, rs193922286, rs193922287, rs193922289, rs193922291, rs193922295, rs193922297, rs193922300, rs193922302, rs193922303, rs193922308, rs193922313, rs193922314, rs144723656, rs193922315, rs193922316, rs193922317, rs148311934, rs193922319, rs193922320, rs193922326, rs193922329, rs193922330, rs193922331, rs193922335, rs193922336, rs193922338, rs193922340, rs193922341, rs193922471, rs193922475, rs193922476, rs193922479, rs80356663, rs193922355, rs193922356, rs193922576, rs193922578, rs193922582, rs193922588, rs193922592, rs193922594, rs193922596, rs386134267, rs193922598, rs193922599, rs193922600, rs193922604, rs193922605, rs397514580, rs397515519, rs267601516, rs587780343, rs587780345, rs587780346, rs587780347, rs587780357, rs148954387, rs587783672, rs587783669, rs786204676, rs794727236, rs151344624, rs794727775, rs794727839, rs199946797, rs869320673, rs796065047, rs759072800, rs797045595, rs797045209, rs797045207, rs797045213, rs863225280, rs149703259, rs864321656, rs139964066, rs777870079, rs878853246, rs769268803, rs886039380, rs886041392, rs886041391, rs886042610, rs143064649, rs1057516192, rs746480424, rs1057516281, rs576684889, rs754728827, rs1057520291, rs1057520779, rs893256143, rs1057520504, rs1057524790, rs1057524902, rs1057524904, rs1057524905, rs764232985, rs1064793998, rs1064794268, rs769086289, rs369429452, rs1085307913, rs1131691416, rs765432081, rs1131692182, rs748749585, rs1554335441, rs762263694, rs1312678560, rs767565869, rs1375656631, rs1554335391, rs1360415315, rs1554335616, rs1554335752, rs1554909277, rs769518471, rs757171524, rs768951263, rs762703502, rs1555212248, rs1555212359, rs1555813319, rs1555816654, rs371977235, rs1415041911, rs1554334894, rs1260178539, rs1554335421, rs1555211904, rs779184183, rs1554335564, rs200670692, rs1400535021, rs1554334872, rs1555212749, rs1553876668, rs1553878211, rs954727530, rs1554924035, rs372307320, rs925231098, rs1554913069, rs1554933565, rs766431403, rs746714109, rs751279984, rs770664202, rs1008906426, rs758844607, rs1554924540, rs1566092307, rs753998395, rs1565885935, rs1167124132, rs1376796469, rs556436603, rs1562715657, rs1486280029, rs1564869850, rs755259997, rs769569410, rs1172328722, rs1286294151, rs1375557127, rs1568731279, rs1562715426, rs556581174, rs1564865302, rs1565886545, rs1568724014, rs1392795567, rs781260712, rs1562719705, rs1382448285, rs1564977373, rs750586210, rs1598842892, rs1583592247, rs780612692, rs1593060859, rs1476637197, rs751279776, rs1593060890, rs1191912908, rs1167675604, rs1583601110, rs1593058932, rs778611627, rs753296261	26301688
Inflammatory bowel disease	Inflammatory Bowel Diseases	rs137853579, rs137853580, rs121909601, rs149491038, rs368287711, rs387907326, rs587777338, rs758439420, rs1329427406, rs1264862631, rs1192830343, rs1373354533, rs1419560997, rs1591263883, rs1989014468	26192919
Leukemia	Leukemia, Myelocytic, Acute	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297	27903959
Multiple sclerosis	Multiple Sclerosis, NON RARE IN EUROPE: Multiple sclerosis	rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039, rs483353038, rs61731956, rs568165874, rs767480544	24076602, 27386562, 22190364
Psoriasis	Psoriasis	rs281875215, rs587777763, rs281875213, rs281875212	26974007, 26301688
Rheumatoid arthritis	Rheumatoid Arthritis, Rheumatoid Arthritis, Systemic Juvenile	rs587776843	20453842, 23143596, 24390342, 30423114, 22446963, 28706201, 24532676, 23603761

Unknown
Disease term	Disease name	Evidence	References	Source
Celiac disease	Celiac Disease		26301688	ClinVar
Crohn disease	Crohn Disease		26301688, 23128233, 26192919, 26974007	ClinVar
Multiple Sclerosis	Multiple Sclerosis			GWAS
Crohn Disease	Crohn Disease			GWAS
Stress Disorder	Stress Disorder			GWAS
Inflammatory Bowel Disease	Inflammatory Bowel Disease			GWAS
Dermatitis	Dermatitis			GWAS
Coronary artery disease	Coronary artery disease			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Arthritis Rheumatoid	Associate	22355377, 26895230, 31620119, 31945409, 35111166
Asthma	Associate	31945409
Autoimmune Diseases	Associate	28470010, 31620119
Dermatomyositis	Associate	28470010, 30157932
Diabetes Mellitus Type 2	Inhibit	30352878
Glaucoma Open Angle	Associate	29452408
Lung Diseases Interstitial	Associate	28470010
Multiple Sclerosis	Associate	31620119, 31945409, 35111166
Myotonic Dystrophy	Associate	28470010
Neoplasms Adipose Tissue	Associate	30352878
Neuroectodermal Tumors Primitive	Associate	33536079
Osteoarthritis	Associate	31945409
Polymyositis	Associate	28470010, 30157932
Simpson Golabi Behmel syndrome	Associate	31739742
Stress Disorders Post Traumatic	Associate	27167565
Wounds and Injuries	Associate	27167565