CALCB (calcitonin related polypeptide beta)

Gene

• Entrez ID: 797
• Gene name: Calcitonin related polypeptide beta
• Gene symbol: CALCB
• Synonyms (NCBI Gene): CALC2, CGRP-II, CGRP2
• Chromosome: 11
• Chromosome location: 11p15.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT027442	hsa-miR-98-5p	Microarray	19088304
MIRT1954971	hsa-miR-183	CLIP-seq
MIRT1954972	hsa-miR-338-5p	CLIP-seq
MIRT2192585	hsa-miR-4528	CLIP-seq
MIRT2192586	hsa-miR-4795-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005179	Function	Hormone activity	IDA	1318039
GO:0005179	Function	Hormone activity	IEA
GO:0005184	Function	Neuropeptide hormone activity	TAS	2985435
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	1318039
GO:0005615	Component	Extracellular space	IEA
GO:0006874	Process	Intracellular calcium ion homeostasis	TAS	2985435
GO:0007165	Process	Signal transduction	TAS	2985435
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	9620797, 17110384
GO:0031716	Function	Calcitonin receptor binding	IBA
GO:0048018	Function	Receptor ligand activity	IEA
GO:0051480	Process	Regulation of cytosolic calcium ion concentration	IBA
GO:0097646	Process	Calcitonin family receptor signaling pathway	IEA
GO:1990408	Process	Calcitonin gene-related peptide receptor signaling pathway	IDA	9620797
GO:1990408	Process	Calcitonin gene-related peptide receptor signaling pathway	IDA	9620797

Other IDs

• MIM: 114160
• HGNC: 1438
• e!Ensembl: ENSG00000175868

Protein

• UniProt ID: P10092
• Protein name: Calcitonin gene-related peptide 2 (CGRP2) (Beta-type CGRP) (Beta-CGRP) (Calcitonin gene-related peptide II) (CGRP-II)
• Protein function: CALCB/CGRP2 is a peptide hormone that induces vasodilation mediated by the CALCRL-RAMP1 receptor complex (PubMed:1318039, PubMed:9620797). Dilates a variety of vessels including the coronary, cerebral and systemic vasculature. Its abundance in t
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00214	Calc_CGRP_IAPP	1 → 123	Calcitonin / CGRP / IAPP family	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in spinal cord, pituitary and thalamus. {ECO:0000269|PubMed:3492492}.
• Sequence:

  MGFRKFSPFLALSILVLYQAGSLQAAPFRSALESSPDPATLSKEDARLLLAALVQDYVQM
  KASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFGR
  RRRDLQA

• Sequence length: 127

Pathways

KEGG:

Neuroactive ligand-receptor interaction
Hormone signaling
Vascular smooth muscle contraction

Reactome:

G alpha (s) signalling events
Calcitonin-like ligand receptors
ADORA2B mediated anti-inflammatory cytokines production