CALCB (calcitonin related polypeptide beta)

Gene

• Entrez ID: 797
• Gene name: Calcitonin related polypeptide beta
• Gene symbol: CALCB
• Synonyms (NCBI Gene): CALC2, CGRP-II, CGRP2
• Chromosome: 11
• Chromosome location: 11p15.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT027442	hsa-miR-98-5p	Microarray	19088304
MIRT1954971	hsa-miR-183	CLIP-seq
MIRT1954972	hsa-miR-338-5p	CLIP-seq
MIRT2192585	hsa-miR-4528	CLIP-seq
MIRT2192586	hsa-miR-4795-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005184	Function	Neuropeptide hormone activity	TAS	2985435
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0006874	Process	Cellular calcium ion homeostasis	TAS	2985435
GO:0007165	Process	Signal transduction	TAS	2985435
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	21873635
GO:0031716	Function	Calcitonin receptor binding	IBA	21873635
GO:0051480	Process	Regulation of cytosolic calcium ion concentration	IBA	21873635

Other IDs

• MIM: 114160
• HGNC: 1438
• e!Ensembl: ENSG00000175868

Protein

• UniProt ID: P10092
• Protein name: Calcitonin gene-related peptide 2 (CGRP2) (Beta-type CGRP) (Beta-CGRP) (Calcitonin gene-related peptide II) (CGRP-II)
• Protein function: CALCB/CGRP2 is a peptide hormone that induces vasodilation mediated by the CALCRL-RAMP1 receptor complex (PubMed:1318039, PubMed:9620797). Dilates a variety of vessels including the coronary, cerebral and systemic vasculature. Its abundance in t
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00214	Calc_CGRP_IAPP	1 → 123	Calcitonin / CGRP / IAPP family	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in spinal cord, pituitary and thalamus. {ECO:0000269|PubMed:3492492}.
• Sequence:

  MGFRKFSPFLALSILVLYQAGSLQAAPFRSALESSPDPATLSKEDARLLLAALVQDYVQM
  KASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFGR
  RRRDLQA

• Sequence length: 127

Pathways

KEGG:

Neuroactive ligand-receptor interaction
Hormone signaling
Vascular smooth muscle contraction

Reactome:

G alpha (s) signalling events
Calcitonin-like ligand receptors
ADORA2B mediated anti-inflammatory cytokines production

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158, rs80357524, rs80357115, rs80357945, rs80357729, rs80357609, rs80357259, rs80357981, rs80358063, rs80357389, rs80356862, rs80359876, rs80357580, rs80358053, rs80358089, rs80187739, rs397507241, rs80358069, rs80357590, rs80357284, rs80357941, rs80359261, rs80359272, rs80359276, rs276174813, rs80358474, rs80359316, rs1555282969, rs80359388, rs80359499, rs80359505, rs80359520, rs80359526, rs80359533, rs56253082, rs80358824, rs80359554, rs80359636, rs80359651, rs80359659, rs80359011, rs80359012, rs80359013, rs80359718, rs397507410, rs81002812, rs80359730, rs80359152, rs80359159, rs397507419, rs28897759, rs80359211, rs80359775, rs397514577, rs397507584, rs80358435, rs80358456, rs80359340, rs80359343, rs80359365, rs80358579, rs397507670, rs80358593, rs80359406, rs80359444, rs80359454, rs276174853, rs276174854, rs80359483, rs80359537, rs80358815, rs80358843, rs80359558, rs80359560, rs80359594, rs80358893, rs28897743, rs397507900, rs397507906, rs397507918, rs80358971, rs80358981, rs397507941, rs80359030, rs80359035, rs41293511, rs397507396, rs81002806, rs80359112, rs397508006, rs81002893, rs45580035, rs80359760, rs397508051, rs80359772, rs4987049, rs80359777, rs80357770, rs397508867, rs62625303, rs397508874, rs80357506, rs80357287, rs273898674, rs80358042, rs80358083, rs80357058, rs41286296, rs80357960, rs80356945, rs80357223, rs386134270, rs80358116, rs80357856, rs80357424, rs397509050, rs80357485, rs80357966, rs397509067, rs80357310, rs80356866, rs80357260, rs80357437, rs80358023, rs80358086, rs80357133, rs80356993, rs80357997, rs80357239, rs80357227, rs397509243, rs80356969, rs80356959, rs63750617, rs63751319, rs587779315, rs200640585, rs398122546, rs80357543, rs398122687, rs80359328, rs398122779, rs398122783, rs62517194, rs80358029, rs515726060, rs180177103, rs180177111, rs180177133, rs587776527, rs180177135, rs180177136, rs515726117, rs587779813, rs587779909, rs587780024, rs587780100, rs28909982, rs121908698, rs180177100, rs587780210, rs587780240, rs587780639, rs587781269, rs587781353, rs587781471, rs587781658, rs587781697, rs587781730, rs587781894, rs587781948, rs587782005, rs587782011, rs200928781, rs587781558, rs370228071, rs587782245, rs587782401, rs180177110, rs587782504, rs72552322, rs587782531, rs587782620, rs587782680, rs587782774, rs587782818, rs730881411, rs730881389, rs564652222, rs397507768, rs587776419, rs730881868, rs730881940, rs56383036, rs758972589, rs201089102, rs730881348, rs786202608, rs786201886, rs786203318, rs786203775, rs786203714, rs786202033, rs750621215, rs786203884, rs786203650, rs772821016, rs863224521, rs864622223, rs864622655, rs375699023, rs876659572, rs768362387, rs876659535, rs876658957, rs483353072, rs876659435, rs267608041, rs876661113, rs730881369, rs878853535, rs772228129, rs878855122, rs760551339, rs80359596, rs397509222, rs886039630, rs886039683, rs886040828, rs587781799, rs886040374, rs886040649, rs397507967, rs878854957, rs886040043, rs1057517589, rs1060502769, rs866380588, rs863224765, rs1064793243, rs747563556, rs1555074976, rs1064795885, rs753961188, rs1064794708, rs869312772, rs1064793887, rs1131690820, rs1135401928, rs1135401868, rs1135401859, rs1553370324, rs397507630, rs1555283160, rs1555283251, rs1555283262, rs1555283361, rs1555286298, rs1555288462, rs886040950, rs1555289566, rs776323117, rs80357123, rs1555579627, rs1555580697, rs80358054, rs1555593302, rs1328985852, rs763470424, rs1555139694, rs878854697, rs1555461217, rs1555461765, rs774684620, rs766416564, rs1554558613, rs1305740166, rs1555461460, rs1555461407, rs1555461586, rs1555567202, rs1555607022, rs1555069815, rs1442299125, rs1474786480, rs1555084947, rs1555457867, rs141087784, rs1482641121, rs1564830522, rs1565469955, rs1565503137, rs864622613, rs755263466, rs757679199, rs1593903166, rs1597801649, rs1603293306, rs879253880, rs80358754, rs1597062038, rs45494092, rs1603275367, rs887358871, rs1597091518, rs1966967065, rs1064793049, rs2082872908, rs2085078278, rs2072475243	20852631

Unknown
Disease term	Disease name	Evidence	References	Source
Diverticulitis	Diverticulitis			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Allanson Pantzar McLeod syndrome	Associate	24240197
Autoimmune Pancreatitis	Associate	28151472
Carcinoma Adenoid Cystic	Associate	34234876
Compartment Syndromes	Associate	24240197
Diabetes Mellitus Type 2	Associate	36368953
Heart Failure	Associate	2346957
Migraine Disorders	Associate	33155547
Neoplasms	Associate	2269360
Paralyses Familial Periodic	Associate	24240197
Raynaud Disease	Associate	29698501
Thyroid cancer medullary	Associate	2269360, 3492492