Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
79698
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger matrin-type 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZMAT4
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8p11.21
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT029334 hsa-miR-26b-5p Microarray 19088304
MIRT540497 hsa-miR-8485 HITS-CLIP 19536157
MIRT540491 hsa-miR-383-3p HITS-CLIP 19536157
MIRT540490 hsa-miR-1296-5p HITS-CLIP 19536157
MIRT540489 hsa-miR-2909 HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003676 Function Nucleic acid binding IEA
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 25416956, 25910212, 26871637, 32296183
GO:0005634 Component Nucleus IEA
GO:0008270 Function Zinc ion binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein
UniProt ID Q9H898
Protein name Zinc finger matrin-type protein 4
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12874 zf-met 14 38 Domain
PF12874 zf-met 75 99 Domain
PF12171 zf-C2H2_jaz 144 170 Zinc-finger double-stranded RNA-binding Family
PF12874 zf-met 198 222 Domain
Sequence
MKSSDIDQDLFTDSYCKVCSAQLISESQRVAHYESRKHASKVRLYYMLHPRDGGCPAKRL
RSENGSDADMVDKNKCCTLCNMSFTSAVVADSHYQGKIHAKRLKLLLGEKTPLKTTATPL
SPLKPPRMDTAPVVASPYQRRDSDRYCGLCAAWFNNPLMAQQHYDGKKHKKNAARVALLE
QLGTTLDMGELRGLRRNYRCTICSVSLNSIEQYHAHLKGSKHQTNLKNK
Sequence length 229
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Anemia Severe aplastic anemia N/A N/A GWAS
Fibromuscular Dysplasia Fibromuscular dysplasia N/A N/A GWAS
Myopia Myopia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 36982708
Cardiovascular Diseases Associate 28253292
Coronary Artery Disease Associate 35472719
Glaucoma Associate 36982708
Hematologic Neoplasms Associate 21269563
Leukemia Lymphocytic Chronic B Cell Associate 21269563
Leukemia Myelogenous Chronic BCR ABL Positive Associate 21269563
Leukemia Myeloid Acute Associate 21269563
Metabolic Diseases Associate 28253292
Multiple Myeloma Associate 21269563