Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	79661
Gene name Gene Name - the full gene name approved by the HGNC.	Nei like DNA glycosylase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NEIL1
Synonyms (NCBI Gene) Gene synonyms aliases	FPG1, NEI1, hFPG1
Chromosome Chromosome number	15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	15q24.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is a member of the Nei endonuclease VIII-like gene family which encodes DNA glycosylases. The encoded enzyme participates in the DNA repair pathway by initiating base excision repair by removing damaged bases, primarily oxidized pyrimidines. Mul

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs556576971	->C	Conflicting-interpretations-of-pathogenicity	Intron variant, coding sequence variant, frameshift variant, 5 prime UTR variant, non coding transcript variant

Show/Hide all(14)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017116	hsa-miR-335-5p	Microarray	18185580
MIRT1180020	hsa-miR-103a	CLIP-seq
MIRT1180021	hsa-miR-105	CLIP-seq
MIRT1180022	hsa-miR-107	CLIP-seq
MIRT1180023	hsa-miR-23a	CLIP-seq
MIRT1180024	hsa-miR-23b	CLIP-seq
MIRT1180025	hsa-miR-23c	CLIP-seq
MIRT1180026	hsa-miR-4310	CLIP-seq
MIRT1180027	hsa-miR-4328	CLIP-seq
MIRT1180028	hsa-miR-4477a	CLIP-seq
MIRT1180029	hsa-miR-4717-3p	CLIP-seq
MIRT1180030	hsa-miR-5096	CLIP-seq
MIRT1180031	hsa-miR-548c-3p	CLIP-seq
MIRT1180032	hsa-miR-556-5p	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
JUN	Activation	16118226

Show/Hide all(39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003684	Function	Damaged DNA binding	IEA
GO:0003824	Function	Catalytic activity	IEA
GO:0003906	Function	DNA-(apurinic or apyrimidinic site) endonuclease activity	IBA
GO:0003906	Function	DNA-(apurinic or apyrimidinic site) endonuclease activity	IEA
GO:0003906	Function	DNA-(apurinic or apyrimidinic site) endonuclease activity	TAS
GO:0005515	Function	Protein binding	IPI	17611195
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	17611195
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IDA	17611195
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0006281	Process	DNA repair	IEA
GO:0006281	Process	DNA repair	IEA
GO:0006284	Process	Base-excision repair	IBA
GO:0006284	Process	Base-excision repair	IDA	17611195
GO:0006284	Process	Base-excision repair	IEA
GO:0006287	Process	Base-excision repair, gap-filling	TAS
GO:0006974	Process	DNA damage response	IEA
GO:0006979	Process	Response to oxidative stress	IDA	17611195
GO:0008270	Function	Zinc ion binding	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016798	Function	Hydrolase activity, acting on glycosyl bonds	IDA	17611195
GO:0016798	Function	Hydrolase activity, acting on glycosyl bonds	IEA
GO:0016799	Function	Hydrolase activity, hydrolyzing N-glycosyl compounds	IEA
GO:0016829	Function	Lyase activity	IEA
GO:0019104	Function	DNA N-glycosylase activity	IBA
GO:0019104	Function	DNA N-glycosylase activity	IEA
GO:0019104	Function	DNA N-glycosylase activity	TAS
GO:0032074	Process	Negative regulation of nuclease activity	IDA	17611195
GO:0045008	Process	Depyrimidination	TAS
GO:0140078	Function	Class I DNA-(apurinic or apyrimidinic site) endonuclease activity	IEA

MIM	HGNC	e!Ensembl
608844	18448	ENSG00000140398

Protein

UniProt ID

Q96FI4

Protein name

Endonuclease 8-like 1 (EC 3.2.2.-) (EC 4.2.99.18) (DNA glycosylase/AP lyase Neil1) (DNA-(apurinic or apyrimidinic site) lyase Neil1) (Endonuclease VIII-like 1) (FPG1) (Nei homolog 1) (NEH1) (Nei-like protein 1)

Protein function

Involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Acts as a DNA glycosylase that recognizes and removes damaged bases. Has a preference for oxidized pyrimidines, such as thymine glycol, formamidopyrimidine (Fap

PDB

1TDH , 4NRV , 5ITQ , 5ITR , 5ITT , 5ITU , 5ITX , 5ITY , 6LWA , 6LWB , 6LWC , 6LWD , 6LWF , 6LWG , 6LWH , 6LWI , 6LWJ , 6LWK , 6LWL , 6LWM , 6LWN , 6LWO , 6LWP , 6LWQ , 6LWR , 7TMX , 8FTJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01149	Fapy_DNA_glyco	1 → 123	Formamidopyrimidine-DNA glycosylase N-terminal domain	Domain
PF09292	Neil1-DNA_bind	252 → 290	Endonuclease VIII-like 1, DNA bind	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11904416}.

Sequence

MPEGPELHLASQFVNEACRALVFGGCVEKSSVSRNPEVPFESSAYRISASARGKELRLIL
SPLPGAQPQQEPLALVFRFGMSGSFQLVPREELPRHAHLRFYTAPPGPRLALCFVDIRRF
GRWDLGGKWQPGRGPCVLQEYQQFRENVLRNLADKAFDRPICEALLDQRFFNGIGNYLRA
EILYRLKIPPFEKARSVLEALQQHRPSPELTLSQKIRTKLQNPDLLELCHSVPKEVVQLG
GKGYGSESGEEDFAAFRAWLRCYGMPGMSSLQDRHGRTIWFQGDPGPLAPKGRKSRKKKS
KATQLSPEDRVEDALPPSKAPSRTRRAKRDLPKRTATQRPEGTSLQQDPEAPTVPKKGRR
KGRQAASGHCRPRKVKADIPSLEPEGTSAS

Sequence length

390

Interactions

View interactions

	KEGG		Reactome
	Base excision repair		Recognition and association of DNA glycosylase with site containing an affected pyrimidine Cleavage of the damaged pyrimidine APEX1-Independent Resolution of AP Sites via the Single Nucleotide Replacement Pathway Defective Base Excision Repair Associated with NEIL1

NEIL1 (nei like DNA glycosylase 1)