Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
79660
Gene name Gene Name - the full gene name approved by the HGNC.
Protein phosphatase 1 regulatory subunit 3B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PPP1R3B
Synonyms (NCBI Gene) Gene synonyms aliases
GL, PPP1R4, PTG
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8p23.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes the catalytic subunit of the serine/theonine phosphatase, protein phosphatase-1. The encoded protein is expressed in liver and skeletal muscle tissue and may be involved in regulating glycogen synthesis in these tissues. This gene may be
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017328 hsa-miR-335-5p Microarray 18185580
MIRT022373 hsa-miR-124-3p Microarray 18668037
MIRT679347 hsa-miR-6858-3p HITS-CLIP 23824327
MIRT530480 hsa-miR-4676-5p HITS-CLIP 23824327
MIRT530479 hsa-miR-575 HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000164 Component Protein phosphatase type 1 complex IBA
GO:0000164 Component Protein phosphatase type 1 complex IEA
GO:0004721 Function Phosphoprotein phosphatase activity IEA
GO:0005515 Function Protein binding IPI 15231748, 32296183, 33961781
GO:0005977 Process Glycogen metabolic process IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610541 14942 ENSG00000173281
Protein
UniProt ID Q86XI6
Protein name Protein phosphatase 1 regulatory subunit 3B (Hepatic glycogen-targeting protein phosphatase 1 regulatory subunit GL) (Protein phosphatase 1 regulatory subunit 4) (PP1 subunit R4) (Protein phosphatase 1 subunit GL) (PTG)
Protein function Acts as a glycogen-targeting subunit for phosphatase PP1. Facilitates interaction of the PP1 with enzymes of the glycogen metabolism and regulates its activity. Suppresses the rate at which PP1 dephosphorylates (inactivates) glycogen phosphoryla
PDB 2EEF , 5ZT0
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03370 CBM_21 127 233 Carbohydrate/starch-binding module (family 21) Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in the liver and, at lower levels, in skeletal muscle, including in vastus lateralis, gastrocnemius and soleus (at protein level). Highest mRNA levels are observed in skeletal muscle, and only moderate levels in liver
Sequence
MMAVDIEYRYNCMAPSLRQERFAFKISPKPSKPLRPCIQLSSKNEASGMVAPAVQEKKVK
KRVSFADNQGLALTMVKVFSEFDDPLDMPFNITELLDNIVSLTTAESESFVLDFSQPSAD
YLDFRNRLQADHVCLENCVLKDKAIAGTVKVQNLAFEKTVKIRMTFDTWKSYTDFPCQYV
KDTYAGSDRDTFSFDISLPEKIQSYERMEFAVYYECNGQTYWDSNRGKNYRII
RAELKST
QGMTKPHSGPDLGISFDQFGSPRCSYGLFPEWPSYLGYEKLGPYY
Sequence length 285
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Insulin signaling pathway
Insulin resistance
 
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Cholelithiasis Cholelithiasis N/A N/A GWAS
Diabetes Type 2 diabetes N/A N/A GWAS
Gout Gout N/A N/A GWAS
Hypertension Essential hypertension (time to event) N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Diabetes Mellitus Associate 26433129, 28334935, 30629617
Diabetes Mellitus Type 2 Associate 30629617, 31554886
Fatty Liver Associate 23416328, 32898995
Fatty Liver Alcoholic Associate 26845607
Glycogen Storage Disease Associate 33231259
Liver Diseases Associate 27752939
Mason Type Diabetes Associate 30629617
Melanoma Associate 23690473
Metabolic Syndrome Associate 33231259
Myocardial Infarction Associate 33231259