Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
79648
Gene name Gene Name - the full gene name approved by the HGNC.
Microcephalin 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MCPH1
Synonyms (NCBI Gene) Gene synonyms aliases
BRIT1, MCT
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8p23.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a DNA damage response protein. The encoded protein may play a role in G2/M checkpoint arrest via maintenance of inhibitory phosphorylation of cyclin-dependent kinase 1. Mutations in this gene have been associated with primary autosomal r
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs41313952 T>C Uncertain-significance, conflicting-interpretations-of-pathogenicity Coding sequence variant, non coding transcript variant, missense variant
rs77959215 A>C Conflicting-interpretations-of-pathogenicity, uncertain-significance Coding sequence variant, missense variant, non coding transcript variant
rs121434305 C>G Pathogenic Genic upstream transcript variant, stop gained, coding sequence variant, 5 prime UTR variant, non coding transcript variant
rs139607465 C>A,G,T Uncertain-significance, likely-benign, conflicting-interpretations-of-pathogenicity Coding sequence variant, synonymous variant, missense variant, intron variant, non coding transcript variant
rs139678787 A>G,T Conflicting-interpretations-of-pathogenicity Genic upstream transcript variant, coding sequence variant, synonymous variant, 5 prime UTR variant, non coding transcript variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017612 hsa-miR-335-5p Microarray 18185580
MIRT047634 hsa-miR-10a-5p CLASH 23622248
MIRT046507 hsa-miR-15b-5p CLASH 23622248
MIRT1137975 hsa-miR-1184 CLIP-seq
MIRT1137976 hsa-miR-1297 CLIP-seq
Transcription factors
Transcription factor Regulation Reference
E2F1 Activation 22136275
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 12837246
GO:0000132 Process Establishment of mitotic spindle orientation IEA
GO:0000278 Process Mitotic cell cycle IBA 21873635
GO:0005515 Function Protein binding IPI 18660752, 19287395
GO:0005654 Component Nucleoplasm TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607117 6954 ENSG00000147316
Protein
UniProt ID Q8NEM0
Protein name Microcephalin
Protein function Implicated in chromosome condensation and DNA damage induced cellular responses. May play a role in neurogenesis and regulation of the size of the cerebral cortex. {ECO:0000269|PubMed:12046007, ECO:0000269|PubMed:15199523, ECO:0000269|PubMed:152
PDB 2WT8 , 3KTF , 3PA6 , 3SHT , 3SHV , 3SZM , 3T1N , 3U3Z , 7C5D
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12738 PTCB-BRCT 9 75 twin BRCT domain Family
PF12258 Microcephalin 225 607 Microcephalin protein Family
PF16589 BRCT_2 752 832 BRCT domain, a BRCA1 C-terminus domain Family
Tissue specificity TISSUE SPECIFICITY: Expressed in fetal brain, liver and kidney. {ECO:0000269|PubMed:12046007}.
Sequence
MAAPILKDVVAYVEVWSSNGTENYSKTFTTQLVDMGAKVSKTFNKQVTHVIFKDGYQSTW
DKAQKRGVKLVSVLW
VEKCRTAGAHIDESLFPAANMNEHLSSLIKKKRKCMQPKDFNFKT
PENDKRFQKKFEKMAKELQRQKTNLDDDVPILLFESNGSLIYTPTIEINSRHHSAMEKRL
QEMKEKRENLSPTSSQMIQQSHDNPSNSLCEAPLNISRDTLCSDEYFAGGLHSSFDDLCG
NSGCGNQERKLEGSINDIKSDVCISSLVLKANNIHSSPSFTHLDKSSPQKFLSNLSKEEI
NLQRNIAGKVVTPDQKQAAGMSQETFEEKYRLSPTLSSTKGHLLIHSRPRSSSVKRKRVS
HGSHSPPKEKCKRKRSTRRSIMPRLQLCRSEDRLQHVAGPALEALSCGESSYDDYFSPDN
LKERYSENLPPESQLPSSPAQLSCRSLSKKERTSIFEMSDFSCVGKKTRTVDITNFTAKT
ISSPRKTGNGEGRATSSCVTSAPEEALRCCRQAGKEDACPEGNGFSYTIEDPALPKGHDD
DLTPLEGSLEEMKEAVGLKSTQNKGTTSKISNSSEGEAQSEHEPCFIVDCNMETSTEEKE
NLPGGYS
GSVKNRPTRHDVLDDSCDGFKDLIKPHEELKKSGRGKKPTRTLVMTSMPSEKQ
NVVIQVVDKLKGFSIAPDVCETTTHVLSGKPLRTLNVLLGIARGCWVLSYDWVLWSLELG
HWISEEPFELSHHFPAAPLCRSECHLSAGPYRGTLFADQPAMFVSPASSPPVAKLCELVH
LCGGRVSQVPRQASIVIGPYSGKKKATVKYLSEKWVLDSITQHKVCAPENYL
LSQ
Sequence length 835
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Condensation of Prophase Chromosomes
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Agenesis of corpus callosum Agenesis of corpus callosum rs754914260, rs1057519053, rs1057519056, rs1057519054, rs1057519055, rs1057519057, rs1384496494, rs1599017933
Breast cancer Breast Cancer, Familial rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
16217032, 19525936, 19549900, 23729656, 16872911, 26820313, 25362854
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
Mental retardation Severe intellectual disability, Intellectual Disability rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315
View all (1024 more)
Unknown
Disease term Disease name Evidence References Source
Breast Carcinoma hereditary breast carcinoma GenCC
Ovarian cancer familial ovarian cancer Conditional KD of IL6 in the OCCA xenograft model delays tumor growth GenCC, CBGDA
Asthma Asthma GWAS
Breast Cancer Breast Cancer Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients GWAS, CBGDA
Associations from Text Mining
Disease Name Relationship Type References
Acute Kidney Injury Associate 32680471
Adenocarcinoma of Lung Associate 24460291
Alzheimer Disease Associate 21297427, 32193444
Aphasia Associate 33094427
Ataxia Telangiectasia Associate 25301947
Autistic Disorder Associate 18716609, 22139841, 23575222
Autosomal Recessive Primary Microcephaly Associate 10677332, 15220350, 16217032, 17220170, 17564965, 17925396, 18664457, 18718915, 19525936, 19549900, 21150325, 22139841, 22952573, 23983231, 24830737
View all (11 more)
Bipolar Disorder Associate 30859703
Brain Neoplasms Associate 26820313
Breast Neoplasms Associate 18635967, 23729656, 26820313, 30809794, 33809336