Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	79621
Gene name	Ribonuclease H2 subunit B
Gene symbol	RNASEH2B
Synonyms (NCBI Gene)	AGS2DLEU8
Chromosome	13
Chromosome location	13q14.3
Summary	RNase H2 is composed of a single catalytic subunit (A) and two non-catalytic subunits (B and C) and specifically degrades the RNA of RNA:DNA hybrids. The protein encoded by this gene is the non-catalytic B subunit of RNase H2, which is thought to play a r

Show/Hide all (19)

SNP ID	Visualize variation	Clinical significance	Consequence
rs74555752	T>G	Pathogenic	Missense variant, coding sequence variant
rs75184679	G>A	Pathogenic-likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs75186889	G>-	Pathogenic	5 prime UTR variant, splice donor variant, coding sequence variant
rs75325951	T>G	Likely-pathogenic	5 prime UTR variant, missense variant, coding sequence variant
rs77301371	G>A	Pathogenic	Splice donor variant
rs78705382	C>T	Uncertain-significance, likely-pathogenic	5 prime UTR variant, missense variant, coding sequence variant
rs79310911	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs146451037	A>G	Conflicting-interpretations-of-pathogenicity, uncertain-significance, likely-benign	Missense variant, coding sequence variant
rs367915667	G>A	Likely-pathogenic	Splice donor variant
rs372632599	C>G,T	Pathogenic	Stop gained, coding sequence variant, missense variant
rs777313709	G>A	Pathogenic	Splice acceptor variant
rs778933609	T>C,G	Likely-pathogenic	Coding sequence variant, missense variant
rs786205483	A>G	Pathogenic-likely-pathogenic, likely-pathogenic	Missense variant, coding sequence variant, 5 prime UTR variant
rs1057517815	A>G	Likely-pathogenic	Intron variant
rs1064797046	G>A	Likely-pathogenic	Intron variant
rs1342532406	G>A	Likely-pathogenic	Intron variant
rs1452451283	G>-	Pathogenic	Frameshift variant, coding sequence variant, 5 prime UTR variant
rs1555257383	G>T	Pathogenic	Stop gained, coding sequence variant
rs1593470515	G>-	Likely-pathogenic	Coding sequence variant, splice donor variant

210

Show/Hide all (210)

miRTarBase ID	miRNA	Experiments	Reference
MIRT043749	hsa-miR-328-3p	CLASH	23622248
MIRT694085	hsa-miR-34b-3p	HITS-CLIP	23313552
MIRT694084	hsa-miR-216a-5p	HITS-CLIP	23313552
MIRT694083	hsa-miR-216b-5p	HITS-CLIP	23313552
MIRT694082	hsa-miR-6808-5p	HITS-CLIP	23313552
MIRT694081	hsa-miR-6893-5p	HITS-CLIP	23313552
MIRT694080	hsa-miR-940	HITS-CLIP	23313552
MIRT694079	hsa-miR-3929	HITS-CLIP	23313552
MIRT694078	hsa-miR-4419b	HITS-CLIP	23313552
MIRT694077	hsa-miR-4478	HITS-CLIP	23313552
MIRT694076	hsa-miR-3614-5p	HITS-CLIP	23313552
MIRT694075	hsa-miR-6500-3p	HITS-CLIP	23313552
MIRT694074	hsa-miR-5690	HITS-CLIP	23313552
MIRT694073	hsa-miR-4768-3p	HITS-CLIP	23313552
MIRT694072	hsa-miR-6746-5p	HITS-CLIP	23313552
MIRT694071	hsa-miR-6787-3p	HITS-CLIP	23313552
MIRT694070	hsa-miR-4649-3p	HITS-CLIP	23313552
MIRT694069	hsa-miR-1827	HITS-CLIP	23313552
MIRT694068	hsa-miR-485-5p	HITS-CLIP	23313552
MIRT694067	hsa-miR-6884-5p	HITS-CLIP	23313552
MIRT694066	hsa-miR-4722-5p	HITS-CLIP	23313552
MIRT694065	hsa-miR-7160-5p	HITS-CLIP	23313552
MIRT694064	hsa-miR-6771-5p	HITS-CLIP	23313552
MIRT694063	hsa-miR-665	HITS-CLIP	23313552
MIRT631727	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT631726	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT631725	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT631724	hsa-miR-6742-3p	HITS-CLIP	23824327
MIRT631723	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT631722	hsa-miR-3605-3p	HITS-CLIP	23824327
MIRT631721	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT631720	hsa-miR-6776-5p	HITS-CLIP	23824327
MIRT631719	hsa-miR-2277-3p	HITS-CLIP	23824327
MIRT631718	hsa-miR-4252	HITS-CLIP	23824327
MIRT631717	hsa-miR-661	HITS-CLIP	23824327
MIRT631716	hsa-miR-542-3p	HITS-CLIP	23824327
MIRT631715	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT631714	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT631713	hsa-miR-7703	HITS-CLIP	23824327
MIRT631712	hsa-miR-1262	HITS-CLIP	23824327
MIRT631711	hsa-miR-4701-3p	HITS-CLIP	23824327
MIRT631710	hsa-miR-6736-5p	HITS-CLIP	23824327
MIRT457848	hsa-miR-4481	PAR-CLIP	24398324
MIRT457849	hsa-miR-4745-5p	PAR-CLIP	24398324
MIRT457847	hsa-miR-4708-3p	PAR-CLIP	24398324
MIRT457846	hsa-miR-6077	PAR-CLIP	24398324
MIRT457845	hsa-miR-766-5p	PAR-CLIP	24398324
MIRT457844	hsa-miR-6878-5p	PAR-CLIP	24398324
MIRT457843	hsa-miR-6731-5p	PAR-CLIP	24398324
MIRT457842	hsa-miR-8085	PAR-CLIP	24398324
MIRT457841	hsa-miR-7106-5p	PAR-CLIP	24398324
MIRT457840	hsa-miR-6825-5p	PAR-CLIP	24398324
MIRT457839	hsa-miR-1233-5p	PAR-CLIP	24398324
MIRT457838	hsa-miR-6778-5p	PAR-CLIP	24398324
MIRT457837	hsa-miR-561-5p	PAR-CLIP	24398324
MIRT457836	hsa-miR-30c-1-3p	PAR-CLIP	24398324
MIRT457835	hsa-miR-30c-2-3p	PAR-CLIP	24398324
MIRT457834	hsa-miR-6788-5p	PAR-CLIP	24398324
MIRT457848	hsa-miR-4481	PAR-CLIP	23592263
MIRT457849	hsa-miR-4745-5p	PAR-CLIP	23592263
MIRT457847	hsa-miR-4708-3p	PAR-CLIP	23592263
MIRT457846	hsa-miR-6077	PAR-CLIP	23592263
MIRT457845	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT457844	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT457843	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT457842	hsa-miR-8085	PAR-CLIP	23592263
MIRT457841	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT457840	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT457839	hsa-miR-1233-5p	PAR-CLIP	23592263
MIRT457838	hsa-miR-6778-5p	PAR-CLIP	23592263
MIRT457836	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT457835	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT457834	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT457848	hsa-miR-4481	PAR-CLIP	23592263
MIRT457849	hsa-miR-4745-5p	PAR-CLIP	23592263
MIRT457847	hsa-miR-4708-3p	PAR-CLIP	23592263
MIRT457846	hsa-miR-6077	PAR-CLIP	23592263
MIRT457845	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT457844	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT457843	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT457842	hsa-miR-8085	PAR-CLIP	23592263
MIRT457841	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT457840	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT457839	hsa-miR-1233-5p	PAR-CLIP	23592263
MIRT457838	hsa-miR-6778-5p	PAR-CLIP	23592263
MIRT457837	hsa-miR-561-5p	PAR-CLIP	23592263
MIRT457836	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT457835	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT457834	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT694085	hsa-miR-34b-3p	HITS-CLIP	23313552
MIRT694084	hsa-miR-216a-5p	HITS-CLIP	23313552
MIRT694083	hsa-miR-216b-5p	HITS-CLIP	23313552
MIRT694082	hsa-miR-6808-5p	HITS-CLIP	23313552
MIRT694081	hsa-miR-6893-5p	HITS-CLIP	23313552
MIRT694080	hsa-miR-940	HITS-CLIP	23313552
MIRT694079	hsa-miR-3929	HITS-CLIP	23313552
MIRT694078	hsa-miR-4419b	HITS-CLIP	23313552
MIRT694077	hsa-miR-4478	HITS-CLIP	23313552
MIRT694076	hsa-miR-3614-5p	HITS-CLIP	23313552
MIRT694075	hsa-miR-6500-3p	HITS-CLIP	23313552
MIRT694074	hsa-miR-5690	HITS-CLIP	23313552
MIRT694073	hsa-miR-4768-3p	HITS-CLIP	23313552
MIRT694072	hsa-miR-6746-5p	HITS-CLIP	23313552
MIRT694071	hsa-miR-6787-3p	HITS-CLIP	23313552
MIRT694070	hsa-miR-4649-3p	HITS-CLIP	23313552
MIRT694069	hsa-miR-1827	HITS-CLIP	23313552
MIRT694068	hsa-miR-485-5p	HITS-CLIP	23313552
MIRT694067	hsa-miR-6884-5p	HITS-CLIP	23313552
MIRT694066	hsa-miR-4722-5p	HITS-CLIP	23313552
MIRT694065	hsa-miR-7160-5p	HITS-CLIP	23313552
MIRT694064	hsa-miR-6771-5p	HITS-CLIP	23313552
MIRT694063	hsa-miR-665	HITS-CLIP	23313552
MIRT631727	hsa-miR-508-5p	HITS-CLIP	23824327
MIRT631726	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT631725	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT631724	hsa-miR-6742-3p	HITS-CLIP	23824327
MIRT631723	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT631722	hsa-miR-3605-3p	HITS-CLIP	23824327
MIRT631721	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT631720	hsa-miR-6776-5p	HITS-CLIP	23824327
MIRT631719	hsa-miR-2277-3p	HITS-CLIP	23824327
MIRT631718	hsa-miR-4252	HITS-CLIP	23824327
MIRT631717	hsa-miR-661	HITS-CLIP	23824327
MIRT631716	hsa-miR-542-3p	HITS-CLIP	23824327
MIRT631715	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT631714	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT631713	hsa-miR-7703	HITS-CLIP	23824327
MIRT631712	hsa-miR-1262	HITS-CLIP	23824327
MIRT631711	hsa-miR-4701-3p	HITS-CLIP	23824327
MIRT631710	hsa-miR-6736-5p	HITS-CLIP	23824327
MIRT457848	hsa-miR-4481	PAR-CLIP	24398324
MIRT457849	hsa-miR-4745-5p	PAR-CLIP	24398324
MIRT457847	hsa-miR-4708-3p	PAR-CLIP	24398324
MIRT457846	hsa-miR-6077	PAR-CLIP	24398324
MIRT457845	hsa-miR-766-5p	PAR-CLIP	24398324
MIRT457844	hsa-miR-6878-5p	PAR-CLIP	24398324
MIRT457843	hsa-miR-6731-5p	PAR-CLIP	24398324
MIRT457842	hsa-miR-8085	PAR-CLIP	24398324
MIRT457841	hsa-miR-7106-5p	PAR-CLIP	24398324
MIRT457840	hsa-miR-6825-5p	PAR-CLIP	24398324
MIRT457839	hsa-miR-1233-5p	PAR-CLIP	24398324
MIRT457838	hsa-miR-6778-5p	PAR-CLIP	24398324
MIRT457837	hsa-miR-561-5p	PAR-CLIP	24398324
MIRT457836	hsa-miR-30c-1-3p	PAR-CLIP	24398324
MIRT457835	hsa-miR-30c-2-3p	PAR-CLIP	24398324
MIRT457834	hsa-miR-6788-5p	PAR-CLIP	24398324
MIRT457848	hsa-miR-4481	PAR-CLIP	23592263
MIRT457849	hsa-miR-4745-5p	PAR-CLIP	23592263
MIRT457847	hsa-miR-4708-3p	PAR-CLIP	23592263
MIRT457846	hsa-miR-6077	PAR-CLIP	23592263
MIRT457845	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT457844	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT457843	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT457842	hsa-miR-8085	PAR-CLIP	23592263
MIRT457841	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT457840	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT457839	hsa-miR-1233-5p	PAR-CLIP	23592263
MIRT457838	hsa-miR-6778-5p	PAR-CLIP	23592263
MIRT457836	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT457835	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT457834	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT457848	hsa-miR-4481	PAR-CLIP	23592263
MIRT457849	hsa-miR-4745-5p	PAR-CLIP	23592263
MIRT457847	hsa-miR-4708-3p	PAR-CLIP	23592263
MIRT457846	hsa-miR-6077	PAR-CLIP	23592263
MIRT457845	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT457844	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT457843	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT457842	hsa-miR-8085	PAR-CLIP	23592263
MIRT457841	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT457840	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT457839	hsa-miR-1233-5p	PAR-CLIP	23592263
MIRT457838	hsa-miR-6778-5p	PAR-CLIP	23592263
MIRT457837	hsa-miR-561-5p	PAR-CLIP	23592263
MIRT457836	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT457835	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT457834	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT1308712	hsa-miR-1321	CLIP-seq
MIRT1308713	hsa-miR-140-5p	CLIP-seq
MIRT1308714	hsa-miR-197	CLIP-seq
MIRT1308715	hsa-miR-224	CLIP-seq
MIRT1308716	hsa-miR-3545-5p	CLIP-seq
MIRT1308717	hsa-miR-376c	CLIP-seq
MIRT1308718	hsa-miR-4270	CLIP-seq
MIRT1308719	hsa-miR-4441	CLIP-seq
MIRT1308720	hsa-miR-4460	CLIP-seq
MIRT1308721	hsa-miR-4685-5p	CLIP-seq
MIRT1308722	hsa-miR-4739	CLIP-seq
MIRT1308723	hsa-miR-4756-5p	CLIP-seq
MIRT1308724	hsa-miR-552	CLIP-seq
MIRT1308725	hsa-miR-764	CLIP-seq
MIRT2091595	hsa-miR-375	CLIP-seq
MIRT2091596	hsa-miR-873	CLIP-seq
MIRT2316186	hsa-miR-106a	CLIP-seq
MIRT2316187	hsa-miR-106b	CLIP-seq
MIRT2316188	hsa-miR-17	CLIP-seq
MIRT2316189	hsa-miR-20a	CLIP-seq
MIRT2316190	hsa-miR-20b	CLIP-seq
MIRT2316191	hsa-miR-298	CLIP-seq
MIRT2316192	hsa-miR-3613-3p	CLIP-seq
MIRT2316193	hsa-miR-3662	CLIP-seq
MIRT2316194	hsa-miR-519a	CLIP-seq
MIRT2316195	hsa-miR-519b-3p	CLIP-seq
MIRT2316196	hsa-miR-519c-3p	CLIP-seq
MIRT2316197	hsa-miR-519d	CLIP-seq
MIRT2316198	hsa-miR-548t	CLIP-seq
MIRT2316199	hsa-miR-582-5p	CLIP-seq
MIRT2316200	hsa-miR-93	CLIP-seq
MIRT1308714	hsa-miR-197	CLIP-seq
MIRT1308715	hsa-miR-224	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001701	Process	In utero embryonic development	IEA
GO:0005515	Function	Protein binding	IPI	30889214
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0006139	Process	Nucleobase-containing compound metabolic process	IEA
GO:0006298	Process	Mismatch repair	NAS	21177858
GO:0006401	Process	RNA catabolic process	IBA
GO:0006401	Process	RNA catabolic process	IDA	21177858
GO:0009259	Process	Ribonucleotide metabolic process	IEA
GO:0010389	Process	Regulation of G2/M transition of mitotic cell cycle	IEA
GO:0010467	Process	Gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0032299	Component	Ribonuclease H2 complex	IBA
GO:0032299	Component	Ribonuclease H2 complex	IDA	21177858
GO:0032299	Component	Ribonuclease H2 complex	IEA
GO:0032299	Component	Ribonuclease H2 complex	IPI	21177858
GO:0048144	Process	Fibroblast proliferation	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IEA
GO:2000001	Process	Regulation of DNA damage checkpoint	IEA

MIM	HGNC	e!Ensembl
610326	25671	ENSG00000136104

Q5TBB1

Protein name

Ribonuclease H2 subunit B (RNase H2 subunit B) (Aicardi-Goutieres syndrome 2 protein) (AGS2) (Deleted in lymphocytic leukemia 8) (Ribonuclease HI subunit B)

Protein function

Non catalytic subunit of RNase H2, an endonuclease that specifically degrades the RNA of RNA:DNA hybrids. Participates in DNA replication, possibly by mediating the removal of lagging-strand Okazaki fragment RNA primers during DNA replication. M

PDB

3P56 , 3P87 , 3PUF , 8YJZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF17745	Ydr279_N	25 → 92	Ydr279p protein triple barrel domain	Domain
PF09468	RNase_H2-Ydr279	95 → 229	Ydr279p protein family (RNase H2 complex component) wHTH domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:16845400}.

Sequence

MAAGVDCGDGVGARQHVFLVSEYLKDASKKMKNGLMFVKLVNPCSGEGAIYLFNMCLQQL
FEVKVFKEKHHSWFINQSVQSGGLLHFATPVDPLFLLLHYLIKADKEGKFQPLDQVVVDN
VFPNCILLLKLPGLEKLLHHVTEEKGNPEIDNKKYYKYSKEKTLKWLEKKVNQTVAALKT
NNVNVSSRVQSTAFFSGDQASTDKEEDYIRYAHGLISDYIPKELSDDLSKYLKLPEPSAS
LPNPPSKKIKLSDEPVEAKEDYTKFNTKDLKTEKKNSKMTAAQKALAKVDKSGMKSIDTF
FGVKNKKKIGKV

Sequence length

312

Interactions

View interactions

	KEGG
	DNA replication

508

Show/Hide Causal Diseases (10)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Abnormality of the nervous system	Likely pathogenic; Pathogenic	rs75184679	RCV001813931
Aicardi Goutieres syndrome	Pathogenic; Likely pathogenic	rs2137952274, rs75184679, rs1337018128, rs367915667, rs75186889, rs75325951	RCV003235636 RCV000343151 RCV003490846 RCV001192743 RCV004800537 RCV004689883
Aicardi-Goutieres syndrome 1	Likely pathogenic; Pathogenic	rs786205483	RCV003987401
Aicardi-Goutieres syndrome 2	Likely pathogenic; Pathogenic	rs80087649, rs74876702, rs2137866137, rs2137982729, rs75326546, rs2137952274, rs2137925083, rs2137866660, rs75184679, rs74555752, rs786205483, rs772788079, rs367915667, rs2541543792, rs767139201 View all (20 more)	RCV002046000 RCV001384074 RCV002007221 RCV001993362 RCV001917925 RCV001946895 RCV001863437 RCV001914163 RCV000001324 RCV000001325 RCV000492016 RCV002635953 RCV002819933 RCV003030068 RCV003495346 RCV003496314 RCV003495657 RCV003496579 RCV003496806 RCV003601692 RCV003602266 RCV003602284 RCV003602244 RCV003599934 RCV003601145 RCV003600381 RCV001857924 RCV000650223 RCV000706699 RCV000685946 RCV000687242 RCV000794275 RCV000805861 RCV000820778 RCV000805649 RCV001090173 RCV003495241
Autism spectrum disorder	Likely pathogenic; Pathogenic	rs75184679	RCV003125824
Cerebral palsy	Likely pathogenic; Pathogenic	rs75184679	RCV001293274
Clear cell carcinoma of kidney	Likely pathogenic	rs751915137	RCV005931503
Hereditary spastic paraplegia	Likely pathogenic; Pathogenic	rs75184679	RCV005624663
Papillary renal cell carcinoma type 1	Pathogenic	rs75186889	RCV005870795
RNASEH2B-related disorder	Likely pathogenic; Pathogenic	rs75184679, rs75186889	RCV003415614 RCV003918124

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Likely benign	rs41292768	RCV005920772
Cervical cancer	Likely benign	rs41292768	RCV005920774
Cholangiocarcinoma	Likely benign	rs41292768	RCV005920779
Gastric cancer	Likely benign	rs41292768	RCV005920776
Global developmental delay	Conflicting classifications of pathogenicity	rs891972892	RCV000449576
Lung cancer	Likely benign	rs41292768	RCV005920780
Malignant tumor of esophagus	Likely benign	rs41292768	RCV005920773
Ovarian serous cystadenocarcinoma	Likely benign; Benign	rs41292768, rs374358281, rs76413207	RCV005920777 RCV005921286 RCV005893231
Sarcoma	Likely benign; Benign	rs41292768, rs76413207	RCV005920775 RCV005893230
Thymoma	Likely benign; Benign	rs41292768, rs76413207	RCV005920778 RCV005893232
Uterine corpus endometrial carcinoma	Likely benign; Benign	rs41292768, rs76413207	RCV005920781 RCV005893233

Show/Hide Text Mining Associations (41)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adrenoleukodystrophy	Associate	28739201
Aicardi Goutieres syndrome	Associate	17846997, 19015152, 23592335, 24183309, 25604658, 25769924, 28739201, 28762473, 31559893, 31678772, 31920009, 33482855, 33981319, 35262626, 35551623, 37296061, 38041217, 38368708 View all (3 more)
Arthritis	Associate	33482855
Atrophy	Associate	33482855
Baraitser Brett Piesowicz syndrome	Associate	33482855, 35551623
Brain Diseases	Associate	28762473
Carcinoma	Associate	31467233
Cerebellar Diseases	Associate	34655526
Cerebral Palsy	Associate	28762473
Chilblains	Associate	33482855, 35551623
Death	Associate	17846997
Deglutition Disorders	Associate	35551623
Demyelinating Diseases	Associate	26581299
Dystonia	Associate	35551623
Epilepsy	Associate	35551623
Failure to Thrive	Associate	33482855
Fever	Associate	33482855
Genetic Diseases Inborn	Associate	35012964
Growth Disorders	Associate	35551623
Hearing Loss	Associate	33482855
Hereditary Autoinflammatory Diseases	Associate	33482855
Inflammation	Associate	33482855
Intellectual Disability	Associate	35551623
Kidney Diseases	Associate	33482855
Language Disorders	Associate	35551623
Leiomyosarcoma	Associate	38561019
Leukodystrophy Metachromatic	Associate	35551623
Leukoencephalopathies	Associate	26581299, 28762473, 33482855
Liver Failure	Associate	35551623
Lupus Erythematosus Systemic	Associate	35551623
Lymphopenia	Associate	33482855
Microcephaly	Associate	35551623
Microphthalmia Syndromic 10	Associate	35551623
Motor Skills Disorders	Associate	35551623
Muscular dystrophy congenital with central nervous system involvement	Associate	35551623
Neoplasms	Associate	35179959
Prostatic Neoplasms	Associate	32800727, 35179959
Prostatic Neoplasms Castration Resistant	Associate	34103179
Quadriplegia	Associate	28762473
Renal Insufficiency Chronic	Associate	33482855
Thyroid Diseases	Associate	35551623

RNASEH2B (ribonuclease H2 subunit B)