Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
79602
Gene name Gene Name - the full gene name approved by the HGNC.
Adiponectin receptor 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ADIPOR2
Synonyms (NCBI Gene) Gene synonyms aliases
ACDCR2, PAQR2
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12p13.33
Summary Summary of gene provided in NCBI Entrez Gene.
The adiponectin receptors, ADIPOR1 (MIM 607945) and ADIPOR2, serve as receptors for globular and full-length adiponectin (MIM 605441) and mediate increased AMPK (see MIM 602739) and PPAR-alpha (PPARA; MIM 170998) ligand activities, as well as fatty acid o
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT001750 hsa-miR-375 Reporter assay 15806104
MIRT001833 hsa-miR-124-3p Reporter assay 15806104
MIRT052228 hsa-let-7b-5p CLASH 23622248
MIRT133589 hsa-miR-150-5p Microarray, qRT-PCR 22815788
MIRT368206 hsa-miR-548c-3p HITS-CLIP 23313552
Transcription factors
Transcription factor Regulation Reference
ATF3 Repression 20696134
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001934 Process Positive regulation of protein phosphorylation IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005886 Component Plasma membrane IBA 21873635
GO:0005886 Component Plasma membrane TAS
GO:0007507 Process Heart development IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607946 24041 ENSG00000006831
Protein
UniProt ID Q86V24
Protein name Adiponectin receptor protein 2 (Progestin and adipoQ receptor family member 2) (Progestin and adipoQ receptor family member II)
Protein function Receptor for ADIPOQ, an essential hormone secreted by adipocytes that regulates glucose and lipid metabolism (PubMed:12802337, PubMed:25855295). Required for normal body fat and glucose homeostasis. ADIPOQ-binding activates a signaling cascade t
PDB 5LWY , 5LX9 , 5LXA , 6KS1 , 6YX9 , 6YXD , 6YXF , 6YXG
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03006 HlyIII 140 363 Haemolysin-III related Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous (PubMed:16044242). Highly expressed in skeletal muscle, liver and placenta (PubMed:12802337). Weakly expressed in brain, heart, colon, spleen, kidney, thymus, small intestine, peripheral blood leukocytes and lung (PubMed:128
Sequence
MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSE
EHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDF
LLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLGIFYMFRPNISFVAPLQE
KVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIALLIMGSFVPWLYYSFY
CNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFLGLGLSGIIPTLHYVISE
GFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQLFHIFVVAGAF
VHF
HGVSNLQEFRFMIGGGCSEEDAL
Sequence length 386
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Hormone signaling
AMPK signaling pathway
Longevity regulating pathway
Adipocytokine signaling pathway
Non-alcoholic fatty liver disease
Alcoholic liver disease
  AMPK inhibits chREBP transcriptional activation activity