Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	79574
Gene name Gene Name - the full gene name approved by the HGNC.	EPS8 signaling adaptor L3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	EPS8L3
Synonyms (NCBI Gene) Gene synonyms aliases	EPS8R3, HYPT5, MUHH2
Disease Acronyms (UniProt) Disease acronyms from UniProt database	HYPT5
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p13.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein that is related to epidermal growth factor receptor pathway substrate 8 (EPS8), a substrate for the epidermal growth factor receptor. The function of this protein is unknown. Alternatively spliced transcript variants encoding d

Show/Hide all(24)

miRTarBase ID	miRNA	Experiments
MIRT967406	hsa-miR-1253	CLIP-seq
MIRT967407	hsa-miR-1285	CLIP-seq
MIRT967408	hsa-miR-2861	CLIP-seq
MIRT967409	hsa-miR-3126-5p	CLIP-seq
MIRT967410	hsa-miR-3187-5p	CLIP-seq
MIRT967411	hsa-miR-3199	CLIP-seq
MIRT967412	hsa-miR-326	CLIP-seq
MIRT967413	hsa-miR-330-5p	CLIP-seq
MIRT967414	hsa-miR-378g	CLIP-seq
MIRT967415	hsa-miR-4428	CLIP-seq
MIRT967416	hsa-miR-4461	CLIP-seq
MIRT967417	hsa-miR-4486	CLIP-seq
MIRT967418	hsa-miR-4740-5p	CLIP-seq
MIRT967419	hsa-miR-580	CLIP-seq
MIRT967420	hsa-miR-612	CLIP-seq
MIRT967421	hsa-miR-2467-5p	CLIP-seq
MIRT967422	hsa-miR-3121-3p	CLIP-seq
MIRT967423	hsa-miR-3150a-3p	CLIP-seq
MIRT967424	hsa-miR-3175	CLIP-seq
MIRT967425	hsa-miR-409-5p	CLIP-seq
MIRT967426	hsa-miR-4667-5p	CLIP-seq
MIRT967427	hsa-miR-4700-5p	CLIP-seq
MIRT967428	hsa-miR-876-3p	CLIP-seq
MIRT967429	hsa-miR-939	CLIP-seq

Show/Hide all(12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003779	Function	Actin binding	IBA	21873635
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IDA	14565974
GO:0005515	Function	Protein binding	IPI	14565974
GO:0005737	Component	Cytoplasm	IDA	14565974
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0007266	Process	Rho protein signal transduction	IBA	21873635
GO:0032587	Component	Ruffle membrane	IBA	21873635
GO:0035023	Process	Regulation of Rho protein signal transduction	IBA	21873635
GO:0042634	Process	Regulation of hair cycle	IMP	23099647
GO:0050790	Process	Regulation of catalytic activity	IEA
GO:0051015	Function	Actin filament binding	IDA	14565974
GO:1900029	Process	Positive regulation of ruffle assembly	IBA	21873635

MIM	HGNC	e!Ensembl
614989	21297	ENSG00000198758

Protein

UniProt ID

Q8TE67

Protein name

Epidermal growth factor receptor kinase substrate 8-like protein 3 (EPS8-like protein 3) (Epidermal growth factor receptor pathway substrate 8-related protein 3) (EPS8-related protein 3)

PDB

1WXT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08416	PTB	28 → 156	Phosphotyrosine-binding domain	Domain
PF00018	SH3_1	456 → 501	SH3 domain	Domain
PF18016	SAM_3	520 → 583	SAM domain (Sterile alpha motif)	Domain

Sequence

MSRPSSRAIYLHRKEYSQNLTSEPTLLQHRVEHLMTCKQGSQRVQGPEDALQKLFEMDAQ
GRVWSQDLILQVRDGWLQLLDIETKEELDSYRLDSIQAMNVALNTCSYNSILSITVQEPG
LPGTSTLLFQCQEVGAERLKTSLQKALEEELEQRPRLGGLQPGQDRWRGPAMERPLPMEQ
ARYLEPGIPPEQPHQRTLEHSLPPSPRPLPRHTSAREPSAFTLPPPRRSSSPEDPERDEE
VLNHVLRDIELFMGKLEKAQAKTSRKKKFGKKNKDQGGLTQAQYIDCFQKIKHSFNLLGR
LATWLKETSAPELVHILFKSLNFILARCPEAGLAAQVISPLLTPKAINLLQSCLSPPESN
LWMGLGPAWTTSRADWTGDEPLPYQPTFSDDWQLPEPSSQAPLGYQDPVSLRRGSHRLGS
TSHFPQEKTHNHDPQPGDPNSRPSSPKPAQPALKMQVLYEFEARNPRELTVVQGEKLEVL
DHSKRWWLVKNEAGRSGYIPSNILEPLQPGTPGTQGQSPSRVPMLRLSSRPEEVTDWLQA
ENFSTATVRTLGSLTGSQLLRIRPGELQMLCPQEAPRILSRLEAVRRMLGISP

Sequence length

593

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	19223546

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Source
Unknown
Hypotrichosis	hypotrichosis 5	GenCC
Hereditary Hypotrichosis	Marie Unna hereditary hypotrichosis	GenCC
Multiple Sclerosis	Multiple Sclerosis	GWAS

Show/Hide Text Mining Associations (5)

Disease Name	Relationship Type	References
Associations from Text Mining
Disease	Associate	23099647
Huntington Disease	Associate	33049985
Marie Unna congenital hypotrichosis	Associate	23099647
Prostatic Neoplasms	Associate	19223546
Stomach Neoplasms	Associate	37978443

EPS8L3 (EPS8 signaling adaptor L3)